Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZNF415 on 293 cell. [antibody concentration 1ug/ml].)
Mouse anti-Human ZNF415 Polyclonal Antibody | anti-ZNF415 antibody
ZNF415 (Zinc Finger Protein 415)
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF415; Polyclonal Antibody; ZNF415 (Zinc Finger Protein 415); Anti -ZNF415 (Zinc Finger Protein 415); anti-ZNF415 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF415.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MWEHRKEPWTIESQVRVARKPKGWEWIKGVKTDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKKIHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYECNHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMTVRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKCYECDKVFSRNSCLALHQKTHIGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLATHQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRRVHTGEKPYKCNECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTGEKPYKCNECGKSFSVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN
Applicable Applications for anti-ZNF415 antibody
Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence.
Dilution: Immunofluorescence: 1ug/ml
Dilution: Immunofluorescence: 1ug/ml
Immunogen
Full length human ZNF415, aa1-542 (AAH69668.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZNF415 on 293 cell. [antibody concentration 1ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZNF415 on 293 cell. [antibody concentration 1ug/ml].)
Product Categories/Family for anti-ZNF415 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68,798 Da
NCBI Official Full Name
zinc finger protein 415 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 415
NCBI Official Symbol
ZNF415
NCBI Protein Information
zinc finger protein 415
UniProt Protein Name
Zinc finger protein 415
Protein Family
UniProt Gene Name
ZNF415
UniProt Entry Name
ZN415_HUMAN
Uniprot Description
ZNF415: Involved in transcriptional regulation. Transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppresses the transcriptional activities of AP- 1 and p53/TP53. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: C2H2-type zinc finger protein
Chromosomal Location of Human Ortholog: 19q13.42
Cellular Component: microtubule cytoskeleton; cytoplasm; nucleolus
Molecular Function: DNA binding; metal ion binding; transcription factor activity
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Research Articles on ZNF415
Similar Products
Product Notes
The ZNF415 znf415 (Catalog #AAA6008215) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF415 (Zinc Finger Protein 415) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF415 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). Suitable for use in Immunofluorescence. Dilution: Immunofluorescence: 1ug/ml. Researchers should empirically determine the suitability of the ZNF415 znf415 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWEHRKEPWT IESQVRVARK PKGWEWIKGV KTDLSRNCVI KELAPQQEGN PGEVFHTVTL EQHEKHDIEE FCFREIKKKI HDFDCQWRDD ERNCNKVTTA PKENLTCRRD QRDRRGIGNK SIKHQLGLSF LPHPHELQQF QAEGKIYECN HVEKSVNHGS SVSPPQIISS TIKTHVSNKY GTDFICSSLL TQEQKSCIRE KPYRYIECDK ALNHGSHMTV RQVSHSGEKG YKCDLCGKVF SQKSNLARHW RVHTGEKPYK CNECDRSFSR NSCLALHRRV HTGEKPYKCY ECDKVFSRNS CLALHQKTHI GEKPYTCKEC GKAFSVRSTL TNHQVIHSGK KPYKCNECGK VFSQTSSLAT HQRIHTGEKP YKCNECGKVF SQTSSLARHW RIHTGEKPYK CNECGKVFSY NSHLASHRRV HTGEKPYKCN ECGKAFSVHS NLTTHQVIHT GEKPYKCNQC GKGFSVHSSL TTHQVIHTGE KPYKCNECGK SFSVRPNLTR HQIIHTGKKP YKCSDCGKSF SVRPNLFRHQ IIHTKEKPYK RN. It is sometimes possible for the material contained within the vial of "ZNF415, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
