Immunohistochemistry (IHC)
(Human Heart )
Rabbit ZNF336 Polyclonal Antibody | anti-GZF1 antibody
ZNF336 antibody - N-terminal region
Gene Names
GZF1; JLSM; ZBTB23; ZNF336
Reactivity
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, RatTested Species Reactivity: Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZNF336; Polyclonal Antibody; ZNF336 antibody - N-terminal region; ZBTB23; anti-GZF1 antibody
Host
Rabbit
Reactivity
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity: Human
Tested Species Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5-1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LCDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVFLNEKSVDGTRTNVYL
Sequence Length
711
Applicable Applications for anti-GZF1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF336
Replacement Item
This antibody may replace item sc-134181 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Heart )
Immunohistochemistry (IHC)
(Human Heart )
Western Blot (WB)
(WB Suggested Anti-ZNF336 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZNF336 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-GZF1 antibody
This is a rabbit polyclonal antibody against ZNF336. It was validated on Western Blot and immunohistochemistry
Target Description: ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution.
Target Description: ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution.
Product Categories/Family for anti-GZF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
GDNF-inducible zinc finger protein 1 isoform a
NCBI Official Synonym Full Names
GDNF inducible zinc finger protein 1
NCBI Official Symbol
GZF1
NCBI Official Synonym Symbols
JLSM; ZBTB23; ZNF336
NCBI Protein Information
GDNF-inducible zinc finger protein 1
UniProt Protein Name
GDNF-inducible zinc finger protein 1
Protein Family
UniProt Gene Name
GZF1
UniProt Synonym Gene Names
ZBTB23; ZNF336
UniProt Entry Name
GZF1_HUMAN
Uniprot Description
GZF1: Transcriptional repressor. Binds the GZF1 responsive element (GRE) (consensus: 5'-TGCGCN[TG][CA]TATA-3'). May be regulating VSX2/HOX10 expression. Belongs to the krueppel C2H2-type zinc-finger protein family.
Protein type: Transcription factor; Nucleolus; C2H2-type zinc finger protein
Chromosomal Location of Human Ortholog: 20p11.21
Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; nucleolus; nucleus
Molecular Function: sequence-specific DNA binding; metal ion binding
Biological Process: transcription, DNA-dependent; ureteric bud branching; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent
Research Articles on GZF1
Similar Products
Product Notes
The GZF1 gzf1 (Catalog #AAA3201420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF336 antibody - N-terminal region reacts with Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat Tested Species Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF336 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GZF1 gzf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCDVTVSVEY QGVRKDFMAH KAVLAATSKF FKEVFLNEKS VDGTRTNVYL. It is sometimes possible for the material contained within the vial of "ZNF336, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
