Western Blot (WB)
(WB Suggested Anti-ZBTB25 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Rabbit ZBTB25 Polyclonal Antibody | anti-ZBTB25 antibody
ZBTB25 antibody - middle region
Gene Names
ZBTB25; KUP; ZNF46; C14orf51
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZBTB25; Polyclonal Antibody; ZBTB25 antibody - middle region; anti-ZBTB25 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTF
Sequence Length
435
Applicable Applications for anti-ZBTB25 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZBTB25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZBTB25 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-ZBTB25 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-ZBTB25 antibody
This is a rabbit polyclonal antibody against ZBTB25. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation.
Target Description: ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation.
Product Categories/Family for anti-ZBTB25 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
zinc finger and BTB domain-containing protein 25 isoform a
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 25
NCBI Official Symbol
ZBTB25
NCBI Official Synonym Symbols
KUP; ZNF46; C14orf51
NCBI Protein Information
zinc finger and BTB domain-containing protein 25
UniProt Protein Name
Zinc finger and BTB domain-containing protein 25
Protein Family
UniProt Gene Name
ZBTB25
UniProt Synonym Gene Names
C14orf51; KUP; ZNF46
UniProt Entry Name
ZBT25_HUMAN
Uniprot Description
ZBTB25: May be involved in transcriptional regulation.
Protein type: C2H2-type zinc finger protein
Chromosomal Location of Human Ortholog: 14q23-q24
Cellular Component: nucleoplasm; cytoplasm
Molecular Function: protein binding; DNA binding; metal ion binding; transcription factor activity
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; gene expression
Research Articles on ZBTB25
Similar Products
Product Notes
The ZBTB25 zbtb25 (Catalog #AAA3201578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBTB25 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZBTB25 zbtb25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADQQRACPAT QALEEHQKPP VSIKQERCDP ESVISQSHPS PSSEVTGPTF. It is sometimes possible for the material contained within the vial of "ZBTB25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
