Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ZNF331 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Mouse, Rat ZNF331 Polyclonal Antibody | anti-ZNF331 antibody
ZNF331 Polyclonal Antibody
Gene Names
ZNF331; RITA; ZNF361; ZNF463
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ZNF331; Polyclonal Antibody; ZNF331 Polyclonal Antibody; RITA; ZNF361; ZNF463; anti-ZNF331 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS
Sequence Length
463
Applicable Applications for anti-ZNF331 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human ZNF331
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ZNF331 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ZNF331 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-ZNF331 antibody
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-ZNF331 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 53kDa
Observed: 56kDa
Observed: 56kDa
NCBI Official Full Name
zinc finger protein 331
NCBI Official Synonym Full Names
zinc finger protein 331
NCBI Official Symbol
ZNF331
NCBI Official Synonym Symbols
RITA; ZNF361; ZNF463
NCBI Protein Information
zinc finger protein 331
UniProt Protein Name
Zinc finger protein 331
Protein Family
UniProt Gene Name
ZNF331
UniProt Synonym Gene Names
RITA; ZNF361; ZNF463
NCBI Description
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein. [provided by RefSeq, Nov 2015]
Uniprot Description
May be involved in transcriptional regulation. May play a role in spermatogenesis.
Research Articles on ZNF331
Similar Products
Product Notes
The ZNF331 znf331 (Catalog #AAA9135456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF331 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF331 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the ZNF331 znf331 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AYENKSLPTE KNIHEIRASK RNSDRRSKSL GRNWICEGTL ERPQRSRGRY VNQMIINYVK RPATREGTPP RTHQRHHKEN S. It is sometimes possible for the material contained within the vial of "ZNF331, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
