Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Mouse anti-Human EPB41L1 Monoclonal Antibody | anti-EPB41L1 antibody

EPB41L1 (Erythrocyte Membrane Protein Band 4.1-like Protein, DKFZp686H17242, KIAA0338, MGC11072) (FITC)

Gene Names
EPB41L1; 4.1N; MRD11
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EPB41L1; Monoclonal Antibody; EPB41L1 (Erythrocyte Membrane Protein Band 4.1-like Protein; DKFZp686H17242; KIAA0338; MGC11072) (FITC); anti-EPB41L1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D10
Specificity
Recognizes human EPB41L1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
779
Applicable Applications for anti-EPB41L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-88 from human EPB41L1 (NP_818932) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Testing Data

(Detection limit for recombinant GST tagged EPB41L1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPB41L1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-EPB41L1 antibody
May function to confer stability and plasticity to neuronal membrane via multiple interactions, including the spectrin-actin-based cytoskeleton, integral membrane channels and membrane-associated guanylate kinases.
Product Categories/Family for anti-EPB41L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
band 4.1-like protein 1 isoform b
NCBI Official Synonym Full Names
erythrocyte membrane protein band 4.1 like 1
NCBI Official Symbol
EPB41L1
NCBI Official Synonym Symbols
4.1N; MRD11
NCBI Protein Information
band 4.1-like protein 1
UniProt Protein Name
Band 4.1-like protein 1
Protein Family
UniProt Gene Name
EPB41L1
UniProt Synonym Gene Names
KIAA0338; 4.1N
UniProt Entry Name
E41L1_HUMAN

NCBI Description

Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2015]

Uniprot Description

EPB41L1: May function to confer stability and plasticity to neuronal membrane via multiple interactions, including the spectrin-actin-based cytoskeleton, integral membrane channels and membrane-associated guanylate kinases. Defects in EPB41L1 are the cause of mental retardation autosomal dominant type 11 (MRD11). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 20q11.2-q12

Cellular Component: cytoskeleton; extrinsic to membrane; plasma membrane; cytosol

Molecular Function: actin binding; structural molecule activity

Biological Process: synaptic transmission; cortical actin cytoskeleton organization and biogenesis

Disease: Mental Retardation, Autosomal Dominant 11

Research Articles on EPB41L1

Similar Products

Product Notes

The EPB41L1 epb41l1 (Catalog #AAA6147046) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EPB41L1 (Erythrocyte Membrane Protein Band 4.1-like Protein, DKFZp686H17242, KIAA0338, MGC11072) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPB41L1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPB41L1 epb41l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPB41L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.