Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF224 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Rabbit ZNF224 Polyclonal Antibody | anti-ZNF224 antibody

ZNF224 antibody - middle region

Gene Names
ZNF224; BMZF2; KOX22; ZNF27; BMZF-2; ZNF233; ZNF255
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF224; Polyclonal Antibody; ZNF224 antibody - middle region; anti-ZNF224 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPYKCVECGKGYKRRLDLD
Sequence Length
707
Applicable Applications for anti-ZNF224 antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF224
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF224 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ZNF224 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-ZNF224 antibody
This is a rabbit polyclonal antibody against ZNF224. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82
NCBI Official Full Name
zinc finger protein 224
NCBI Official Synonym Full Names
zinc finger protein 224
NCBI Official Symbol
ZNF224
NCBI Official Synonym Symbols
BMZF2; KOX22; ZNF27; BMZF-2; ZNF233; ZNF255
NCBI Protein Information
zinc finger protein 224
UniProt Protein Name
Zinc finger protein 224
Protein Family
UniProt Gene Name
ZNF224
UniProt Synonym Gene Names
BMZF2; KOX22; ZNF233; ZNF255; ZNF27; BMZF-2
UniProt Entry Name
ZN224_HUMAN

NCBI Description

This gene encodes a member of the Krueppel C2H2-type zinc-finger family of proteins. The encoded protein represses transcription of the aldolase A gene, which encodes a key enzyme in glycolysis. The encoded zinc-finger protein may also function as a transcriptional co-activator with Wilms' tumor protein 1 to regulate apoptotic genes in leukemia. [provided by RefSeq, Jul 2016]

Uniprot Description

Function: May be involved in transcriptional regulation as a transcriptional repressor. The DEPDC1A-ZNF224 complex may play a critical role in bladder carcinogenesis by repressing the transcription of the A20 gene, leading to transport of NF-KB protein into the nucleus, resulting in suppression of apoptosis of bladder cancer cells. Ref.8

Subunit structure: Interacts with WT1. Interacts with DEPDC1A. Ref.5 Ref.8

Subcellular location: Nucleus. Note: Colocalizes with DEPDC1A at the nucleus. Ref.5 Ref.8

Tissue specificity: Ubiquitous. Mainly expressed in fetal tissues. Ref.5

Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 18 C2H2-type zinc fingers.Contains 1 KRAB domain.

Research Articles on ZNF224

Similar Products

Product Notes

The ZNF224 znf224 (Catalog #AAA3213860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF224 antibody - middle region reacts with Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF224 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF224 znf224 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGEKPFKCEE CGKGFYTNSQ CYSHQRSHSG EKPYKCVECG KGYKRRLDLD. It is sometimes possible for the material contained within the vial of "ZNF224, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.