Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using ZMYM3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human ZMYM3 Polyclonal Antibody | anti-ZMYM3 antibody
ZMYM3 Polyclonal Antibody
Gene Names
ZMYM3; MYM; XFIM; ZNF261; DXS6673E; ZNF198L2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ZMYM3; Polyclonal Antibody; ZMYM3 Polyclonal Antibody; DXS6673E; MYM; XFIM; ZNF198L2; ZNF261; anti-ZMYM3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRA
Sequence Length
1358
Applicable Applications for anti-ZMYM3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ZMYM3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using ZMYM3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using ZMYM3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-ZMYM3 antibody
This gene is located on the X chromosome and is subject to X inactivation. It is highly conserved in vertebrates and most abundantly expressed in the brain. The encoded protein is a component of histone deacetylase-containing multiprotein complexes that function through modifying chromatin structure to keep genes silent. A chromosomal translocation (X;13) involving this gene is associated with X-linked mental retardation. Several alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-ZMYM3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 52kDa; 151kDa; 152kDa
Observed: 152kDa
Observed: 152kDa
NCBI Official Full Name
zinc finger MYM-type protein 3 isoform 2
NCBI Official Synonym Full Names
zinc finger MYM-type containing 3
NCBI Official Symbol
ZMYM3
NCBI Official Synonym Symbols
MYM; XFIM; ZNF261; DXS6673E; ZNF198L2
NCBI Protein Information
zinc finger MYM-type protein 3
UniProt Protein Name
Zinc finger MYM-type protein 3
Protein Family
UniProt Gene Name
ZMYM3
UniProt Synonym Gene Names
DXS6673E; KIAA0385; ZNF261
NCBI Description
This gene is located on the X chromosome and is subject to X inactivation. It is highly conserved in vertebrates and most abundantly expressed in the brain. The encoded protein is a component of histone deacetylase-containing multiprotein complexes that function through modifying chromatin structure to keep genes silent. A chromosomal translocation (X;13) involving this gene is associated with X-linked cognitive disability. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2010]
Uniprot Description
Plays a role in the regulation of cell morphology and cytoskeletal organization.
Similar Products
Product Notes
The ZMYM3 zmym3 (Catalog #AAA9133042) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZMYM3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZMYM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ZMYM3 zmym3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLEPLAPDSP ITLQSPHIEE EETTSIATAR RGSPGQEEEL PQGQPQSPNA PPSPSVGETL GDGINSSQTK PGGSSPPAHP SLPGDGLTAK ASEKPPERKR SERVRRAEPP KPEVVDSTES IPVSDEDSDA MVDDPNDEDF VPFRPRRSPR MSLRSSVSQR A. It is sometimes possible for the material contained within the vial of "ZMYM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
