Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-Zip12 Polyclonal Antibody)

Rabbit Zip12 Polyclonal Antibody | anti-Zip12 antibody

Zip12 Polyclonal Antibody

Gene Names
SLC39A12; ZIP-12; LZT-Hs8; bA570F3.1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
Zip12; Polyclonal Antibody; Zip12 Polyclonal Antibody; SLC39A12; LZT-Hs8; ZIP-12; bA570F3.1; zinc transporter ZIP12; anti-Zip12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.72 mg/ml (varies by lot)
Sequence Length
691
Applicable Applications for anti-Zip12 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1).
Immunogen Sequence
MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
Positive Samples
293T, Mouse Brain, Mouse Eye, Mouse Lung, Rat Brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-Zip12 Polyclonal Antibody)

Western Blot (WB) (Western blot-Zip12 Polyclonal Antibody)
Related Product Information for anti-Zip12 antibody
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 61kDa; 72kDa; 76kDa
Observed: 77kDa
NCBI Official Full Name
zinc transporter ZIP12 isoform 1
NCBI Official Synonym Full Names
solute carrier family 39 member 12
NCBI Official Symbol
SLC39A12
NCBI Official Synonym Symbols
ZIP-12; LZT-Hs8; bA570F3.1
NCBI Protein Information
zinc transporter ZIP12
UniProt Protein Name
Zinc transporter ZIP12
Protein Family
UniProt Gene Name
SLC39A12
UniProt Synonym Gene Names
ZIP12; LZT-Hs8; ZIP-12
UniProt Entry Name
S39AC_HUMAN

NCBI Description

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM, Aug 2008]

Uniprot Description

SLC39A12: Acts as a zinc-influx transporter (Potential). May be partly involved in the outbreak of schizophrenia. Belongs to the ZIP transporter (TC 2.A.5) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p12.33

Cellular Component: perinuclear region of cytoplasm; integral to membrane; plasma membrane; vesicle

Molecular Function: zinc ion transmembrane transporter activity

Biological Process: signal transduction; regulation of microtubule polymerization

Research Articles on Zip12

Similar Products

Product Notes

The Zip12 slc39a12 (Catalog #AAA9140672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Zip12 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Zip12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the Zip12 slc39a12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Zip12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.