Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZIC5 Antibody Titration: 0.125ug/mlPositive Control: Human cerebellum)

Rabbit ZIC5 Polyclonal Antibody | anti-ZIC5 antibody

ZIC5 antibody - N-terminal region

Reactivity
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZIC5; Polyclonal Antibody; ZIC5 antibody - N-terminal region; anti-ZIC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH
Sequence Length
639
Applicable Applications for anti-ZIC5 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZIC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZIC5 Antibody Titration: 0.125ug/mlPositive Control: Human cerebellum)

Western Blot (WB) (WB Suggested Anti-ZIC5 Antibody Titration: 0.125ug/mlPositive Control: Human cerebellum)
Related Product Information for anti-ZIC5 antibody
This is a rabbit polyclonal antibody against ZIon Channel5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZIon Channel5 is a member of the ZIon Channel family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 2, a related family member on chromosome 13. This gene encodes a protein of unknown function.
Product Categories/Family for anti-ZIC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
zinc finger protein ZIC 5
NCBI Official Synonym Full Names
Zic family member 5
NCBI Official Symbol
ZIC5
NCBI Protein Information
zinc finger protein ZIC 5
UniProt Protein Name
Zinc finger protein ZIC 5
Protein Family
UniProt Gene Name
ZIC5
UniProt Entry Name
ZIC5_HUMAN

NCBI Description

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. The encoded protein may act as a transcriptional repressor. Studies in mouse and Xenopus support a role for this gene in neural crest development. Elevated expression of this gene has been observed in various human cancers and may contribute to cancer progression. This gene is closely linked to a related family member on chromosome 13. [provided by RefSeq, Mar 2017]

Uniprot Description

ZIC5: Essential for neural crest development, converting cells from an epidermal fate to a neural crest cell fate. Binds to DNA. Belongs to the GLI C2H2-type zinc-finger protein family.

Protein type: Motility/polarity/chemotaxis; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 13q32.3

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; neural tube closure; forebrain development; cell differentiation

Research Articles on ZIC5

Similar Products

Product Notes

The ZIC5 zic5 (Catalog #AAA3201658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZIC5 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZIC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZIC5 zic5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEPPLSKRNP PALRLADLAT AQVQPLQNMT GFPALAGPPA HSQLRAAVAH. It is sometimes possible for the material contained within the vial of "ZIC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.