Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZFYVE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Rabbit ZFYVE1 Polyclonal Antibody | anti-ZFYVE1 antibody

ZFYVE1 antibody - C-terminal region

Gene Names
ZFYVE1; SR3; DFCP1; TAFF1; ZNFN2A1; PPP1R172
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZFYVE1; Polyclonal Antibody; ZFYVE1 antibody - C-terminal region; anti-ZFYVE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP
Sequence Length
777
Applicable Applications for anti-ZFYVE1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZFYVE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZFYVE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-ZFYVE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-ZFYVE1 antibody
This is a rabbit polyclonal antibody against ZFYVE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZFYVE1 contains two zinc-binding FYVE domains in tandem. This protein binds to phosphatidylinositol-3-phosphate (PtdIns3P) through its FYVE-type zinc finger. It displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.
Product Categories/Family for anti-ZFYVE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
zinc finger FYVE domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
zinc finger FYVE-type containing 1
NCBI Official Symbol
ZFYVE1
NCBI Official Synonym Symbols
SR3; DFCP1; TAFF1; ZNFN2A1; PPP1R172
NCBI Protein Information
zinc finger FYVE domain-containing protein 1
UniProt Protein Name
Zinc finger FYVE domain-containing protein 1
UniProt Gene Name
ZFYVE1
UniProt Synonym Gene Names
DFCP1; KIAA1589; TAFF1; ZNFN2A1
UniProt Entry Name
ZFYV1_HUMAN

NCBI Description

The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate-containing membranes. This protein contains two zinc-binding FYVE domains in tandem and is reported to localize to the Golgi apparatus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Similar Products

Product Notes

The ZFYVE1 zfyve1 (Catalog #AAA3210123) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFYVE1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZFYVE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFYVE1 zfyve1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCDNCYEARN VQLAVTEAQV DDEGGTLIAR KVGEAVQNTL GAVVTAIDIP. It is sometimes possible for the material contained within the vial of "ZFYVE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.