Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZDHHC9Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ZDHHC9 Polyclonal Antibody | anti-ZDHHC9 antibody

ZDHHC9 Antibody - middle region

Gene Names
ZDHHC9; CGI89; DHHC9; MMSA1; MRXSZ; ZNF379; ZNF380; CXorf11; ZDHHC10
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZDHHC9; Polyclonal Antibody; ZDHHC9 Antibody - middle region; anti-ZDHHC9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEES
Sequence Length
364
Applicable Applications for anti-ZDHHC9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZDHHC9Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZDHHC9Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ZDHHC9 antibody
This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked mental retardation. Alternate splicing results in multiple transcript variants that encode the same protein.
Product Categories/Family for anti-ZDHHC9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
palmitoyltransferase ZDHHC9
NCBI Official Synonym Full Names
zinc finger DHHC-type containing 9
NCBI Official Symbol
ZDHHC9
NCBI Official Synonym Symbols
CGI89; DHHC9; MMSA1; MRXSZ; ZNF379; ZNF380; CXorf11; ZDHHC10
NCBI Protein Information
palmitoyltransferase ZDHHC9
UniProt Protein Name
Palmitoyltransferase ZDHHC9
Protein Family
UniProt Gene Name
ZDHHC9
UniProt Synonym Gene Names
CXorf11; ZDHHC10; ZNF379; ZNF380; DHHC-9; DHHC9
UniProt Entry Name
ZDHC9_HUMAN

NCBI Description

This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, May 2010]

Uniprot Description

ZDHHC9: The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. Defects in ZDHHC9 are the cause of mental retardation syndromic X-linked ZDHHC9-related (MRXSZ). A disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Some patients have marfanoid habitus as an additional feature. Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.

Protein type: EC 2.3.1.225; Membrane protein, multi-pass; Membrane protein, integral; Transferase

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; cytoplasm; intrinsic to Golgi membrane; integral to membrane

Molecular Function: zinc ion binding; Ras palmitoyltransferase activity; palmitoyltransferase activity; protein-cysteine S-palmitoleyltransferase activity

Biological Process: peptidyl-S-palmitoyl-L-cysteine biosynthetic process from peptidyl-cysteine; protein palmitoylation

Disease: Mental Retardation, X-linked, Syndromic, Raymond Type

Research Articles on ZDHHC9

Similar Products

Product Notes

The ZDHHC9 zdhhc9 (Catalog #AAA3221454) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZDHHC9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZDHHC9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZDHHC9 zdhhc9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDIKGSWTGK NRVQNPYSHG NIVKNCCEVL CGPLPPSVLD RRGILPLEES. It is sometimes possible for the material contained within the vial of "ZDHHC9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.