Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZDHHC19Sample Type: Lypho Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ZDHHC19 Polyclonal Antibody | anti-ZDHHC19 antibody

ZDHHC19 Antibody - N-terminal region

Gene Names
ZDHHC19; DHHC19
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZDHHC19; Polyclonal Antibody; ZDHHC19 Antibody - N-terminal region; anti-ZDHHC19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPL
Sequence Length
309
Applicable Applications for anti-ZDHHC19 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 91%; Pig: 86%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZDHHC19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZDHHC19Sample Type: Lypho Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZDHHC19Sample Type: Lypho Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZDHHC19 antibody
This is a rabbit polyclonal antibody against ZDHHC19. It was validated on Western Blot

Target Description: ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
probable palmitoyltransferase ZDHHC19
NCBI Official Synonym Full Names
zinc finger DHHC-type containing 19
NCBI Official Symbol
ZDHHC19
NCBI Official Synonym Symbols
DHHC19
NCBI Protein Information
probable palmitoyltransferase ZDHHC19
UniProt Protein Name
Probable palmitoyltransferase ZDHHC19
UniProt Gene Name
ZDHHC19
UniProt Synonym Gene Names
DHHC-19
UniProt Entry Name
ZDH19_HUMAN

Uniprot Description

ZDHHC19: Belongs to the DHHC palmitoyltransferase family.

Protein type: Transferase; Membrane protein, integral; Palmitoyltransferase; EC 2.3.1.225; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: endoplasmic reticulum; integral to membrane

Molecular Function: zinc ion binding; protein-cysteine S-palmitoleyltransferase activity

Biological Process: metabolic process

Research Articles on ZDHHC19

Similar Products

Product Notes

The ZDHHC19 zdhhc19 (Catalog #AAA3200491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZDHHC19 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZDHHC19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZDHHC19 zdhhc19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPCRWLAQNG EWAFPVITGS LFVLTFFSLV SLNFSDPGIL HQGSAEQGPL. It is sometimes possible for the material contained within the vial of "ZDHHC19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.