Mouse anti-Human ZCCHC6 Polyclonal Antibody | anti-ZCCHC6 antibody

ZCCHC6 (Zinc Finger CCHC Domain-containing Protein 6, HS2, KIAA1711, Terminal Uridylyltransferase 7, TUTase 7, TUT7)

Cat. Num. AAA6001568

• Gene Names: ZCCHC6; PAPD6
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZCCHC6; Polyclonal Antibody; ZCCHC6 (Zinc Finger CCHC Domain-containing Protein 6; HS2; KIAA1711; Terminal Uridylyltransferase 7; TUTase 7; TUT7); Anti -ZCCHC6 (Zinc Finger CCHC Domain-containing Protein 6; anti-ZCCHC6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZCCHC6.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAIDKVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFPAIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQRSHFFKLFIY

• Applicable Applications for anti-ZCCHC6 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human ZCCHC6, aa1-412 (AAH32456).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZCCHC6 polyclonal antibody. Western Blot analysis of ZCCHC6 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of ZCCHC6 expression in transfected 293T cell line by ZCCHC6 polyclonal antibody. Lane 1: ZCCHC6 transfected lysate (45.32kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-ZCCHC6 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 21595426
• NCBI GeneID: 79670
• UniProt Accession #: Q5VYS8; Q5H9T0; Q5VYS5; Q5VYS7; Q658Z9; Q659A2; Q6MZJ3; Q8N5F0; Q96N57; Q96NE8; Q9C0F2; Q9H8M6
• Molecular Weight: 171,229 Da
• NCBI Official Full Name: ZCCHC6 protein
• NCBI Official Synonym Full Names: zinc finger, CCHC domain containing 6
• NCBI Official Symbol: ZCCHC6
• NCBI Official Synonym Symbols: PAPD6
• NCBI Protein Information: terminal uridylyltransferase 7; TUTase 7; PAP associated domain containing 6; zinc finger CCHC domain-containing protein 6
• UniProt Protein Name: Terminal uridylyltransferase 7
• Protein Family: Terminal uridylyltransferase
• UniProt Gene Name: ZCCHC6
• UniProt Synonym Gene Names: HS2; KIAA1711; TUT7; TUTase 7
• UniProt Entry Name: TUT7_HUMAN

Uniprot Description

ZCCHC6: Uridylyltransferase that mediates the terminal uridylation of some specific RNAs. Not involved in uridylation of precursor let-7 (pre-let-7) miRNA. Does not play a role in replication-dependent histone mRNA degradation. Belongs to the DNA polymerase type-B-like family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.7.52; RNA-binding; Transferase

Chromosomal Location of Human Ortholog: 9q21

Molecular Function: zinc ion binding; RNA uridylyltransferase activity

Biological Process: RNA 3'-end processing