Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ZBTB8A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit ZBTB8A Polyclonal Antibody | anti-ZBTB8A antibody

ZBTB8A Rabbit pAb

Gene Names
ZBTB8A; BOZF1; ZBTB8; ZNF916A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ZBTB8A; Polyclonal Antibody; ZBTB8A Rabbit pAb; BOZF1; ZBTB8; ZNF916A; anti-ZBTB8A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HEPRKESIKKTKHLRLSQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYCTHVVKRKADLKRHLRCHTGERPYPCQACGKRFSRLDHLSSHFRTIHQACKLICRKCKRHVTDLTGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRWH
Applicable Applications for anti-ZBTB8A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 200-400 of human ZBTB8A (NP_001035531).
Positive Samples
U-87MG, PC-3, HeLa, Mouse lung, Mouse brain, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ZBTB8A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ZBTB8A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Product Categories/Family for anti-ZBTB8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,344 Da
NCBI Official Full Name
zinc finger and BTB domain-containing protein 8A
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 8A
NCBI Official Symbol
ZBTB8A
NCBI Official Synonym Symbols
BOZF1; ZBTB8; ZNF916A
NCBI Protein Information
zinc finger and BTB domain-containing protein 8A; zinc finger and BTB domain containing 8; BTB/POZ and zinc-finger domain-containing factor; BTB/POZ and zinc-finger domains factor on chromosome 1
UniProt Protein Name
Zinc finger and BTB domain-containing protein 8A
UniProt Gene Name
ZBTB8A
UniProt Synonym Gene Names
BOZF1; BOZ-F1
UniProt Entry Name
ZBT8A_HUMAN

Uniprot Description

ZBTB8: May be involved in transcriptional regulation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 1p35.1

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on ZBTB8A

Similar Products

Product Notes

The ZBTB8A zbtb8a (Catalog #AAA9143089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBTB8A Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB8A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ZBTB8A zbtb8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HEPRKESIKK TKHLRLSQPS EVTHYKSSKR EVRTSDSSSH VSQSEEQAQI DAEMDSTPVG YQYGQGSDVT SKSFPDDLPR MRFKCPYCTH VVKRKADLKR HLRCHTGERP YPCQACGKRF SRLDHLSSHF RTIHQACKLI CRKCKRHVTD LTGQVVQEGT RRYRLCNECL AEFGIDSLPI DLEAEQHLMS PSDGDKDSRW H. It is sometimes possible for the material contained within the vial of "ZBTB8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.