Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit ZBTB38 Polyclonal Antibody | anti-ZBTB38 antibody

ZBTB38 antibody - N-terminal region

Gene Names
ZBTB38; CIBZ; ZNF921; PPP1R171
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ZBTB38; Polyclonal Antibody; ZBTB38 antibody - N-terminal region; anti-ZBTB38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNV
Sequence Length
1192
Applicable Applications for anti-ZBTB38 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB38
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(Host: RabbitTarget Name: ZBTB38Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZBTB38Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ZBTB38 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ZBTB38 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ZBTB38 antibody
This is a rabbit polyclonal antibody against ZBTB38. It was validated on Western Blot and immunohistochemistry

Target Description: ZBTB38 contains 10 C2H2-type zinc fingers and 1 BTB (POZ) domain. ZBTB38 acts as a transcriptional activator and may be involved in the differentiation and/or survival of late postmitotic neurons.
Product Categories/Family for anti-ZBTB38 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 38
NCBI Official Symbol
ZBTB38
NCBI Official Synonym Symbols
CIBZ; ZNF921; PPP1R171
NCBI Protein Information
zinc finger and BTB domain-containing protein 38
UniProt Protein Name
Zinc finger and BTB domain-containing protein 38
UniProt Gene Name
ZBTB38
UniProt Entry Name
ZBT38_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger transcriptional activator that binds methylated DNA. The encoded protein can form homodimers or heterodimers through the zinc finger domains. In mouse, inhibition of this protein has been associated with apoptosis in some cell types. [provided by RefSeq, Jun 2010]

Uniprot Description

ZBTB38: Acts as a transcriptional activator. May be involved in the differentiation and/or survival of late postmitotic neurons.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: nucleus

Molecular Function: protein binding; protein homodimerization activity; methyl-CpG binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Disease: Stature Quantitative Trait Locus 10

Research Articles on ZBTB38

Similar Products

Product Notes

The ZBTB38 zbtb38 (Catalog #AAA3205013) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBTB38 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB38 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZBTB38 zbtb38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTVMSLSRDL KDDFHSDTVL SILNEQRIRG ILCDVTIIVE DTKFKAHSNV. It is sometimes possible for the material contained within the vial of "ZBTB38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.