Mouse anti-Human ZBTB32 Polyclonal Antibody | anti-ZBTB32 antibody

ZBTB32 (Zinc Finger and BTB Domain-containing Protein 32, FANCC-interacting Protein, Fanconi Anemia Zinc Finger Protein, FAZF, Testis Zinc Finger Protein, TZFP, Zinc Finger Protein 538, ZNF538)

Cat. Num. AAA6004509

• Gene Names: ZBTB32; Rog; FAXF; FAZF; TZFP; ZNF538
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZBTB32; Polyclonal Antibody; ZBTB32 (Zinc Finger and BTB Domain-containing Protein 32; FANCC-interacting Protein; Fanconi Anemia Zinc Finger Protein; FAZF; Testis Zinc Finger Protein; TZFP; Zinc Finger Protein 538; ZNF538); Anti -ZBTB32 (Zinc Finger and BTB Domain-containing Protein 32; anti-ZBTB32 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZBTB32.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4.
• Concentration: 0.5 mg/ml (varies by lot)
• Sequence: MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS

• Applicable Applications for anti-ZBTB32 antibody: Western Blot (WB), Immunofluorescence (IF).
• Application Notes: Immunofluorescence: 10ug/ml; Optimal dilutions to be determined by the researcher.
• Immunogen: Full length protein corresponding to aa1-302 from human ZBTB32
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZBTB32 expression in human colon using MBS6004509.)

Western Blot (WB)

(Western Blot analysis of ZBTB32 expression in transfected 293T cell line using MBS6004509. Lane 1: ZBTB32 transfected lysate (33.22kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of HeLa cells using MBS6004509 (10ug/ml).)

Product Categories/Family for anti-ZBTB32 antibody

Antibodies; Abs to Fanconi Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 17389298
• NCBI GeneID: 27033
• UniProt Accession #: Q9Y2Y4; Q8WVP2
• Molecular Weight: 52,963 Da
• NCBI Official Full Name: ZBTB32 protein
• NCBI Official Synonym Full Names: zinc finger and BTB domain containing 32
• NCBI Official Symbol: ZBTB32
• NCBI Official Synonym Symbols: Rog; FAXF; FAZF; TZFP; ZNF538
• NCBI Protein Information: zinc finger and BTB domain-containing protein 32; repressor of GATA; zinc finger protein 538; FANCC-interacting protein; testis zinc finger protein; fanconi anemia zinc finger protein
• UniProt Protein Name: Zinc finger and BTB domain-containing protein 32
• Protein Family: Zinc finger and BTB domain-containing protein
• UniProt Gene Name: ZBTB32
• UniProt Synonym Gene Names: FAZF; TZFP; ZNF538
• UniProt Entry Name: ZBT32_HUMAN

Uniprot Description

ZBTB32: DNA-binding protein that binds to the to a 5'- TGTACAGTGT-3' core sequence. May function as a transcriptional transactivator and transcriptional repressor. Probably exerts its repressor effect by preventing GATA3 from binding to DNA. May play a role in regulating the differentiation and activation of helper T-cells. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: nucleoplasm; nuclear chromosome; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; T cell proliferation; hemopoiesis; negative regulation of transcription from RNA polymerase II promoter; DNA repair; regulation of cytokine production