Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: YWHAQSample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human YWHAQ Polyclonal Antibody | anti-YWHAQ antibody

YWHAQ Antibody - middle region

Gene Names
YWHAQ; 1C5; HS1; 14-3-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
YWHAQ; Polyclonal Antibody; YWHAQ Antibody - middle region; anti-YWHAQ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGL
Sequence Length
245
Applicable Applications for anti-YWHAQ antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human YWHAQ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: YWHAQSample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: YWHAQSample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-YWHAQ antibody
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
14-3-3 protein theta
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
NCBI Official Symbol
YWHAQ
NCBI Official Synonym Symbols
1C5; HS1; 14-3-3
NCBI Protein Information
14-3-3 protein theta
UniProt Protein Name
14-3-3 protein theta
Protein Family
UniProt Gene Name
YWHAQ
UniProt Entry Name
1433T_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. [provided by RefSeq, Jul 2008]

Uniprot Description

14-3-3 theta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Associates with c-BCR and BCR-Abl.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 2p25.1

Cellular Component: cytoplasmic vesicle membrane; focal adhesion; membrane; cytoplasm; cytosol

Molecular Function: protein domain specific binding; protein binding; protein N-terminus binding

Biological Process: substantia nigra development; apoptosis; small GTPase mediated signal transduction; negative regulation of transcription, DNA-dependent; protein targeting

Research Articles on YWHAQ

Similar Products

Product Notes

The YWHAQ ywhaq (Catalog #AAA3223087) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YWHAQ Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's YWHAQ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the YWHAQ ywhaq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKGDYFRYLA EVACGDDRKQ TIDNSQGAYQ EAFDISKKEM QPTHPIRLGL. It is sometimes possible for the material contained within the vial of "YWHAQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.