Western Blot (WB)
(Western blot-YIPF7 Polyclonal Antibody)
Rabbit anti-Rat YIPF7 Polyclonal Antibody | anti-YIPF7 antibody
YIPF7 Polyclonal Antibody
Gene Names
YIPF7; FinGER9
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
YIPF7; Polyclonal Antibody; YIPF7 Polyclonal Antibody; FinGER9; protein YIPF7; anti-YIPF7 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.63 mg/ml (varies by lot)
Sequence Length
280
Applicable Applications for anti-YIPF7 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YIPF7 (NP_872398.2).
Immunogen Sequence
MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEM
Positive Samples
Rat Heart, Rat Liver
Cellular Location
Endoplasmic Reticulum Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-YIPF7 Polyclonal Antibody)
Western Blot (WB)
(Western blot-YIPF7 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 7kDa; 14kDa; 23kDa; 30kDa
Observed: 31kDa
Observed: 31kDa
NCBI Official Full Name
protein YIPF7
NCBI Official Synonym Full Names
Yip1 domain family member 7
NCBI Official Symbol
YIPF7
NCBI Official Synonym Symbols
FinGER9
NCBI Protein Information
protein YIPF7
UniProt Protein Name
Protein YIPF7
Protein Family
UniProt Gene Name
YIPF7
UniProt Synonym Gene Names
FINGER9; YIP1B
Uniprot Description
YIPF7: Belongs to the YIP1 family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Endoplasmic reticulum; Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 4p12
Cellular Component: endoplasmic reticulum membrane; integral component of membrane
Research Articles on YIPF7
Similar Products
Product Notes
The YIPF7 yipf7 (Catalog #AAA9140774) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YIPF7 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's YIPF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the YIPF7 yipf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YIPF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
