Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: XRCC6Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human XRCC6 Polyclonal Antibody | anti-XRCC6 antibody

XRCC6 Antibody - C-terminal region

Gene Names
XRCC6; ML8; KU70; TLAA; CTC75; CTCBF; G22P1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
XRCC6; Polyclonal Antibody; XRCC6 Antibody - C-terminal region; anti-XRCC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAY
Sequence Length
609
Applicable Applications for anti-XRCC6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human XRCC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: XRCC6Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: XRCC6Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-XRCC6 antibody
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Product Categories/Family for anti-XRCC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66 kDa
NCBI Official Full Name
X-ray repair cross-complementing protein 6 isoform 1
NCBI Official Synonym Full Names
X-ray repair cross complementing 6
NCBI Official Symbol
XRCC6
NCBI Official Synonym Symbols
ML8; KU70; TLAA; CTC75; CTCBF; G22P1
NCBI Protein Information
X-ray repair cross-complementing protein 6
UniProt Protein Name
X-ray repair cross-complementing protein 6
UniProt Gene Name
XRCC6
UniProt Synonym Gene Names
G22P1; 5'-dRP lyase Ku70; CTC75; CTCBF; Ku70; TLAA
UniProt Entry Name
XRCC6_HUMAN

NCBI Description

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. [provided by RefSeq, Jul 2008]

Uniprot Description

Ku70: a mini-chromosome maintenance protein, essential for the initiation of eukaryotic genome replication. Allows DNA to undergo a single round of replication per cell cycle. Required for the entry in S phase and for cell division.

Protein type: Helicase; EC 3.6.4.-; DNA-binding; DNA repair, damage; Nuclear receptor co-regulator; EC 4.2.99.-; RNA-binding

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; transcription factor complex; nuclear telomere cap complex; membrane; nucleolus; cytosol; nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein C-terminus binding; protein binding; DNA binding; double-stranded DNA binding; damaged DNA binding; double-stranded telomeric DNA binding; 5'-deoxyribose-5-phosphate lyase activity; ATP binding

Biological Process: positive regulation of neurogenesis; V(D)J recombination; transcription, DNA-dependent; viral reproduction; positive regulation of transcription, DNA-dependent; DNA repair; double-strand break repair via nonhomologous end joining; DNA duplex unwinding; DNA ligation; double-strand break repair; positive regulation of interferon type I production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; brain development; negative regulation of transcription, DNA-dependent; telomere maintenance

Research Articles on XRCC6

Similar Products

Product Notes

The XRCC6 xrcc6 (Catalog #AAA3223426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XRCC6 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XRCC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XRCC6 xrcc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVTKRKHDNE GSGSKRPKVE YSEEELKTHI SKGTLGKFTV PMLKEACRAY. It is sometimes possible for the material contained within the vial of "XRCC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.