Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-XK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Rabbit XK Polyclonal Antibody | anti-XK antibody

XK antibody - N-terminal region

Gene Names
XK; KX; NA; NAC; X1k; XKR1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
XK; Polyclonal Antibody; XK antibody - N-terminal region; anti-XK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKE
Sequence Length
444
Applicable Applications for anti-XK antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human XK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-XK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-XK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
Related Product Information for anti-XK antibody
This is a rabbit polyclonal antibody against XK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins.This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-XK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
membrane transport protein XK
NCBI Official Synonym Full Names
X-linked Kx blood group
NCBI Official Symbol
XK
NCBI Official Synonym Symbols
KX; NA; NAC; X1k; XKR1
NCBI Protein Information
membrane transport protein XK
UniProt Protein Name
Membrane transport protein XK
Protein Family
UniProt Gene Name
XK
UniProt Synonym Gene Names
XKR1; XRG1
UniProt Entry Name
XK_HUMAN

NCBI Description

This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

XK: May be involved in sodium-dependent transport of neutral amino acids or oligopeptides. Defects in XK are the cause of McLeod syndrome (MLS). It is an X-linked multisystem disorder characterized by late onset abnormalities in the neuromuscular and hematopoietic systems. Belongs to the XK family.

Protein type: Cell surface; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xp21.1

Cellular Component: integral to membrane

Molecular Function: protein binding; transporter activity

Biological Process: myelination; cellular calcium ion homeostasis; transport; amino acid transport; regulation of axon diameter; skeletal muscle fiber development; regulation of cell size

Disease: Mcleod Syndrome

Research Articles on XK

Similar Products

Product Notes

The XK xk (Catalog #AAA3201729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XK antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's XK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XK xk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHLLQLGPLF RCFEVFCIYF QSGNNEEPYV SITKKRQMPK NGLSEEIEKE. It is sometimes possible for the material contained within the vial of "XK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.