Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of WWP2 expression in transfected 293T cell line by WWP2 polyclonal antibody. Lane 1: WWP2 transfected lysate (36.85kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human WWP2 Polyclonal Antibody | anti-WWP2 antibody

WWP2 (WW Domain-containing Protein 2 Atrophin-1-interacting Protein 2, AIP2, NEDD4-like E3 Ubiquitin-protein Ligase WWP2, WWp2-like)

Gene Names
WWP2; AIP2; WWp2-like
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
WWP2; Polyclonal Antibody; WWP2 (WW Domain-containing Protein 2 Atrophin-1-interacting Protein 2; AIP2; NEDD4-like E3 Ubiquitin-protein Ligase WWP2; WWp2-like); Anti -WWP2 (WW Domain-containing Protein 2 Atrophin-1-interacting Protein 2; anti-WWP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WWP2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPG
Applicable Applications for anti-WWP2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human WWP2, aa1-335 (NP_955455.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WWP2 expression in transfected 293T cell line by WWP2 polyclonal antibody. Lane 1: WWP2 transfected lysate (36.85kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WWP2 expression in transfected 293T cell line by WWP2 polyclonal antibody. Lane 1: WWP2 transfected lysate (36.85kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-WWP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
98,912 Da
NCBI Official Full Name
WWP2
NCBI Official Synonym Full Names
WW domain containing E3 ubiquitin protein ligase 2
NCBI Official Symbol
WWP2
NCBI Official Synonym Symbols
AIP2; WWp2-like
NCBI Protein Information
NEDD4-like E3 ubiquitin-protein ligase WWP2; atrophin-1 interacting protein 2
UniProt Protein Name
NEDD4-like E3 ubiquitin-protein ligase WWP2
UniProt Gene Name
WWP2
UniProt Synonym Gene Names
AIP2
UniProt Entry Name
WWP2_HUMAN

NCBI Description

This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of oncogenic signaling pathways via interactions with Smad proteins and the tumor suppressor PTEN. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 10. [provided by RefSeq, Jul 2012]

Uniprot Description

WWP2: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Polyubiquitinates POU5F1 by 'Lys-63'-linked conjugation and promotes it to proteasomal degradation; in embryonic stem cells (ESCs) the ubiquitination is proposed to regulate POU5F1 protein level. Ubiquitinates EGR2 and promotes it to proteasomal degradation; in T-cells the ubiquitination inhibits activation- induced cell death. Ubiquitinates SLC11A2; the ubiquitination is enhanced by presence of NDFIP1 and NDFIP2. Ubiquitinates RPB1 and promotes it to proteasomal degradation.

Protein type: EC 6.3.2.-; Ligase; EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: membrane; cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity; transcription factor binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; regulation of membrane potential; entry of virus into host cell; protein autoubiquitination; negative regulation of transcription factor activity; protein ubiquitination during ubiquitin-dependent protein catabolic process; protein modification process; protein ubiquitination; negative regulation of protein transport; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of transporter activity

Research Articles on WWP2

Similar Products

Product Notes

The WWP2 wwp2 (Catalog #AAA643541) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WWP2 (WW Domain-containing Protein 2 Atrophin-1-interacting Protein 2, AIP2, NEDD4-like E3 Ubiquitin-protein Ligase WWP2, WWp2-like) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WWP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the WWP2 wwp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASASSSRAG VALPFEKSQL TLKVVSAKPK VHNRQPRINS YVEVAVDGLP SETKKTGKRI GSSELLWNEI IILNVTAQSH LDLKVWSCHT LRNELLGTAS VNLSNVLKNN GGKMENMQLT LNLQTENKGS VVSGGELTIF LDGPTVDLGN VPNGSALTDG SQLPSRDSSG TAVAPENRHQ PPSTNCFGGR SRTHRHSGAS ARTTPATGEQ SPGARSRHRQ PVKNSGHSGL ANGTVNDEPT TATDPEEPSV VGVTSPPAAP LSVTPNPNTT SLPAPATPAE GEEPSTSGTQ QLPAAAQAPD ALPAGWEQRE LPNGRVYYVD HNTKTTTWER PLPPG. It is sometimes possible for the material contained within the vial of "WWP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.