Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WWOXSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse WWOX Polyclonal Antibody | anti-WWOX antibody

WWOX Antibody - middle region

Gene Names
Wwox; WOX1; 5330426P09Rik; 9030416C10Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
WWOX; Polyclonal Antibody; WWOX Antibody - middle region; anti-WWOX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAME
Sequence Length
414
Applicable Applications for anti-WWOX antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse WWOX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WWOXSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WWOXSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-WWOX antibody
Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm (By similarity). May also play a role in tumor necrosis factor (TNF)-mediated cell death. Required for normal bone development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
WW domain-containing oxidoreductase
NCBI Official Synonym Full Names
WW domain-containing oxidoreductase
NCBI Official Symbol
Wwox
NCBI Official Synonym Symbols
WOX1; 5330426P09Rik; 9030416C10Rik
NCBI Protein Information
WW domain-containing oxidoreductase
UniProt Protein Name
WW domain-containing oxidoreductase
UniProt Gene Name
Wwox
UniProt Synonym Gene Names
Wox1

Uniprot Description

WWOX: an enzyme which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). Expressed at high levels in hormonally regulated tissues such as testis, ovary, and prostate. Its SRD domain suggest a role for this gene in steroid metabolism. Shown to be an essential mediator of tumor necrosis factor-alpha-induced apoptosis in the mouse. May play a similar role in the human. May function as a suppressor of tumor growth. Alternative splicing of this gene generates 7 isoforms.

Protein type: Apoptosis; EC 1.1.1.-; Oxidoreductase; Tumor suppressor

Chromosomal Location of Human Ortholog: 8|8 E1

Cellular Component: cytoplasm; cytosol; Golgi apparatus; microvillus; mitochondrion; nucleus; plasma membrane; RNA polymerase II transcription factor complex

Molecular Function: enzyme binding; oxidoreductase activity; protein binding

Biological Process: apoptosis; cellular response to transforming growth factor beta stimulus; intrinsic apoptotic signaling pathway by p53 class mediator; negative regulation of Wnt signaling pathway; osteoblast differentiation; positive regulation of extrinsic apoptotic signaling pathway; positive regulation of extrinsic apoptotic signaling pathway in absence of ligand; positive regulation of transcription from RNA polymerase II promoter; skeletal morphogenesis; Wnt signaling pathway

Research Articles on WWOX

Similar Products

Product Notes

The WWOX wwox (Catalog #AAA3223679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WWOX Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's WWOX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WWOX wwox for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETDENGQVFF VDHINKRTTY LDPRLAFTVD DNPTKPTTRQ RYDGSTTAME. It is sometimes possible for the material contained within the vial of "WWOX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.