Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WISP1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit WISP1 Polyclonal Antibody | anti-WISP1 antibody

WISP1 antibody - middle region

Gene Names
CCN4; WISP1; WISP1c; WISP1i; WISP1tc; WISP1-OT1; WISP1-UT1
Reactivity
Cow, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WISP1; Polyclonal Antibody; WISP1 antibody - middle region; anti-WISP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEV
Sequence Length
367
Applicable Applications for anti-WISP1 antibody
Western Blot (WB)
Homology
Cow: 92%; Human: 100%; Pig: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WISP1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WISP1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-WISP1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellWISP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-WISP1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellWISP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-WISP1 antibody
This is a rabbit polyclonal antibody against WISP1. It was validated on Western Blot

Target Description: This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. It is expressed at a high level in fibroblast cells, and overexpressed in colon tumors. The encoded protein binds to decorin and biglycan, two members of a family of small leucine-rich proteoglycans present in the extracellular matrix of connective tissue, and possibly prevents the inhibitory activity of decorin and biglycan in tumor cell proliferation. It also attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase.
Product Categories/Family for anti-WISP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
WNT1-inducible-signaling pathway protein 1 isoform 1
NCBI Official Synonym Full Names
cellular communication network factor 4
NCBI Official Symbol
CCN4
NCBI Official Synonym Symbols
WISP1; WISP1c; WISP1i; WISP1tc; WISP1-OT1; WISP1-UT1
NCBI Protein Information
WNT1-inducible-signaling pathway protein 1
UniProt Protein Name
WNT1-inducible-signaling pathway protein 1
UniProt Gene Name
WISP1
UniProt Synonym Gene Names
CCN4; WISP-1
UniProt Entry Name
WISP1_HUMAN

NCBI Description

This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. It is expressed at a high level in fibroblast cells, and overexpressed in colon tumors. The encoded protein binds to decorin and biglycan, two members of a family of small leucine-rich proteoglycans present in the extracellular matrix of connective tissue, and possibly prevents the inhibitory activity of decorin and biglycan in tumor cell proliferation. It also attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase. It is 83% identical to the mouse protein at the amino acid level. Multiple alternatively spliced transcript variants have been identified. [provided by RefSeq, Mar 2011]

Uniprot Description

WISP1: Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan. Belongs to the CCN family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.22

Cellular Component: proteinaceous extracellular matrix; extracellular space; cytoplasm

Molecular Function: heparin binding; integrin binding; insulin-like growth factor binding

Biological Process: Wnt receptor signaling pathway; cell-cell signaling; regulation of cell growth; signal transduction; cell adhesion

Research Articles on WISP1

Similar Products

Product Notes

The WISP1 wisp1 (Catalog #AAA3216204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WISP1 antibody - middle region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's WISP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WISP1 wisp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRPPRLWCPH PRRVSIPGHC CEQWVCEDDA KRPRKTAPRD TGAFDAVGEV. It is sometimes possible for the material contained within the vial of "WISP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.