Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WDR48Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human WDR48 Polyclonal Antibody | anti-WDR48 antibody

WDR48 Antibody - C-terminal region

Gene Names
WDR48; P80; UAF1; SPG60
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
WDR48; Polyclonal Antibody; WDR48 Antibody - C-terminal region; anti-WDR48 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEE
Sequence Length
1238
Applicable Applications for anti-WDR48 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human WDR48
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WDR48Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WDR48Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-WDR48 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76 kDa
NCBI Official Full Name
WD repeat-containing protein 48 isoform 2
NCBI Official Synonym Full Names
WD repeat domain 48
NCBI Official Symbol
WDR48
NCBI Official Synonym Symbols
P80; UAF1; SPG60
NCBI Protein Information
WD repeat-containing protein 48
UniProt Protein Name
WD repeat-containing protein 48
UniProt Gene Name
WDR48
UniProt Synonym Gene Names
KIAA1449; UAF1
UniProt Entry Name
WDR48_HUMAN

NCBI Description

The protein encoded by this gene has been shown to interact with ubiquitin specific peptidase 1 (USP1), activating the deubiquitinating activity of USP1 and allowing it to remove the ubiquitin moiety from monoubiquitinated FANCD2. FANCD2 is ubiquitinated in response to DNA damage. [provided by RefSeq, Sep 2016]

Uniprot Description

WDR48: an ubiquitous lysosomal WD40 repeat protein. May play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes. Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein (TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptor TCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP.

Protein type: Ubiquitin conjugating system; Vesicle

Chromosomal Location of Human Ortholog: 3p21.33

Cellular Component: intracellular membrane-bound organelle; lysosome; nucleus

Molecular Function: protein binding

Biological Process: skin development; protein deubiquitination; viral reproduction; skeletal morphogenesis; single fertilization; multicellular organism growth; homeostasis of number of cells; embryonic organ development; spermatogenesis; double-strand break repair via homologous recombination; positive regulation of epithelial cell proliferation

Research Articles on WDR48

Similar Products

Product Notes

The WDR48 wdr48 (Catalog #AAA3220695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR48 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR48 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR48 wdr48 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKKDRLSASD MLQVRKVMEH VYEKIINLDN ESQTTSSSNN EKPGEQEKEE. It is sometimes possible for the material contained within the vial of "WDR48, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.