Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WDR45L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateWDR45B is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit WDR45L Polyclonal Antibody | anti-WDR45B antibody

WDR45L antibody - middle region

Gene Names
WDR45B; WIPI3; WDR45L; WIPI-3; NEDSBAS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR45L; Polyclonal Antibody; WDR45L antibody - middle region; anti-WDR45B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICA
Sequence Length
344
Applicable Applications for anti-WDR45B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WDR45L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WDR45L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateWDR45B is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-WDR45L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateWDR45B is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-WDR45B antibody
This is a rabbit polyclonal antibody against WDR45L. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WDR45L is a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for intera
Product Categories/Family for anti-WDR45B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
WD repeat domain phosphoinositide-interacting protein 3
NCBI Official Synonym Full Names
WD repeat domain 45B
NCBI Official Symbol
WDR45B
NCBI Official Synonym Symbols
WIPI3; WDR45L; WIPI-3; NEDSBAS
NCBI Protein Information
WD repeat domain phosphoinositide-interacting protein 3
UniProt Protein Name
WD repeat domain phosphoinositide-interacting protein 3
UniProt Gene Name
WDR45B
UniProt Synonym Gene Names
WDR45L; WIPI3; WIPI-3
UniProt Entry Name
WIPI3_HUMAN

NCBI Description

This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Tissue specificity: Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers. Ref.4

Sequence similarities: Belongs to the WD repeat SVP1 family.Contains 2 WD repeats.

Sequence caution: The sequence AAC72952.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on WDR45B

Similar Products

Product Notes

The WDR45B wdr45b (Catalog #AAA3202155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR45L antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WDR45L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR45B wdr45b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HGTVHIFAAE DPKRNKQSSL ASASFLPKYF SSKWSFSKFQ VPSGSPCICA. It is sometimes possible for the material contained within the vial of "WDR45L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.