Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WDR40A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit WDR40A Polyclonal Antibody | anti-DCAF12 antibody

WDR40A antibody - N-terminal region

Gene Names
DCAF12; CT102; TCC52; WDR40A; KIAA1892
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR40A; Polyclonal Antibody; WDR40A antibody - N-terminal region; anti-DCAF12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK
Sequence Length
453
Applicable Applications for anti-DCAF12 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR40A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WDR40A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-WDR40A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-DCAF12 antibody
This is a rabbit polyclonal antibody against WDR40A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of WDR40A has not yet been determined.This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.
Product Categories/Family for anti-DCAF12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
DDB1- and CUL4-associated factor 12
NCBI Official Synonym Full Names
DDB1 and CUL4 associated factor 12
NCBI Official Symbol
DCAF12
NCBI Official Synonym Symbols
CT102; TCC52; WDR40A; KIAA1892
NCBI Protein Information
DDB1- and CUL4-associated factor 12
UniProt Protein Name
DDB1- and CUL4-associated factor 12
UniProt Gene Name
DCAF12
UniProt Synonym Gene Names
KIAA1892; TCC52; WDR40A
UniProt Entry Name
DCA12_HUMAN

NCBI Description

This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. [provided by RefSeq, Jul 2009]

Uniprot Description

WDR40A: May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. Belongs to the WD repeat DCAF12 family.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: centrosome; cytoplasm

Biological Process: protein ubiquitination

Research Articles on DCAF12

Similar Products

Product Notes

The DCAF12 dcaf12 (Catalog #AAA3210315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR40A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WDR40A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCAF12 dcaf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARKVVSRKRK APASPGAGSD AQGPQFGWDH SLHKRKRLPP VKRSLVYYLK. It is sometimes possible for the material contained within the vial of "WDR40A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.