Mouse anti-Human WDR34 Polyclonal Antibody | anti-WDR34 antibody

WDR34 (WD Repeat-containing Protein 34, bA216B9.3, DIC5, RP11-216B9.5)

Cat. Num. AAA6010098

• Gene Names: WDR34; DIC5; bA216B9.3; RP11-216B9.5
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: WDR34; Polyclonal Antibody; WDR34 (WD Repeat-containing Protein 34; bA216B9.3; DIC5; RP11-216B9.5); Anti -WDR34 (WD Repeat-containing Protein 34; anti-WDR34 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human WDR34.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGHSHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLDCLAAEVAA

• Applicable Applications for anti-WDR34 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human WDR34, aa1-419.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WDR34 expression in transfected 293T cell line by WDR34 polyclonal antibody. Lane 1: WDR34 transfected lysate (46.09kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-WDR34 antibody

Antibodies; Abs to WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 66267730
• NCBI GeneID: 89891
• NCBI Accession #: NP_443076.2
• NCBI GenBank Nucleotide #: NM_052844.3
• UniProt Accession #: Q96EX3; Q5VXV4; Q9BV46
• Molecular Weight: 57,801 Da
• NCBI Official Full Name: WD repeat-containing protein 34
• NCBI Official Synonym Full Names: WD repeat domain 34
• NCBI Official Symbol: WDR34
• NCBI Official Synonym Symbols: DIC5; bA216B9.3; RP11-216B9.5
• NCBI Protein Information: WD repeat-containing protein 34
• UniProt Protein Name: WD repeat-containing protein 34
• Protein Family: WD repeat-containing protein
• UniProt Gene Name: WDR34
• UniProt Entry Name: WDR34_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

WDR34: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Inhibits the MAP3K7-induced NF-kappa- B activation pathway. Inhibits MAP3K7 phosphorylation at 'Thr-184' and 'Thr-187' upon Il-1 beta stimulation.

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: centriole; cytoplasm; axoneme

Biological Process: organelle organization and biogenesis

Disease: Short-rib Thoracic Dysplasia 11 With Or Without Polydactyly