Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of WDR34 expression in transfected 293T cell line by WDR34 polyclonal antibody. Lane 1: WDR34 transfected lysate (46.09kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human WDR34 Polyclonal Antibody | anti-WDR34 antibody

WDR34 (WD Repeat-containing Protein 34, bA216B9.3, DIC5, RP11-216B9.5)

Gene Names
WDR34; DIC5; bA216B9.3; RP11-216B9.5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
WDR34; Polyclonal Antibody; WDR34 (WD Repeat-containing Protein 34; bA216B9.3; DIC5; RP11-216B9.5); Anti -WDR34 (WD Repeat-containing Protein 34; anti-WDR34 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WDR34.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGHSHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLDCLAAEVAA
Applicable Applications for anti-WDR34 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human WDR34, aa1-419.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WDR34 expression in transfected 293T cell line by WDR34 polyclonal antibody. Lane 1: WDR34 transfected lysate (46.09kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WDR34 expression in transfected 293T cell line by WDR34 polyclonal antibody. Lane 1: WDR34 transfected lysate (46.09kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-WDR34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,801 Da
NCBI Official Full Name
WD repeat-containing protein 34
NCBI Official Synonym Full Names
WD repeat domain 34
NCBI Official Symbol
WDR34
NCBI Official Synonym Symbols
DIC5; bA216B9.3; RP11-216B9.5
NCBI Protein Information
WD repeat-containing protein 34
UniProt Protein Name
WD repeat-containing protein 34
UniProt Gene Name
WDR34
UniProt Entry Name
WDR34_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

WDR34: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Inhibits the MAP3K7-induced NF-kappa- B activation pathway. Inhibits MAP3K7 phosphorylation at 'Thr-184' and 'Thr-187' upon Il-1 beta stimulation.

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: centriole; cytoplasm; axoneme

Biological Process: organelle organization and biogenesis

Disease: Short-rib Thoracic Dysplasia 11 With Or Without Polydactyly

Research Articles on WDR34

Similar Products

Product Notes

The WDR34 wdr34 (Catalog #AAA6010098) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WDR34 (WD Repeat-containing Protein 34, bA216B9.3, DIC5, RP11-216B9.5) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR34 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the WDR34 wdr34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVIRELNKNW QSHAFDGFEV NWTEQQQMVS CLYTLGYPPA QAQGLHVTSI SWNSTGSVVA CAYGRLDHGD WSTLKSFVCA WNLDRRDLRP QQPSAVVEVP SAVLCLAFHP TQPSHVAGGL YSGEVLVWDL SRLEDPLLWR TGLTDDTHTD PVSQVVWLPE PGHSHRFQVL SVATDGKVLL WQGIGVGQLQ LTEGFALVMQ QLPRSTKLKK HPRGETEVGA TAVAFSSFDP RLFILGTEGG FPLKCSLAAG EAALTRMPSS VPLRAPAQFT FSPHGGPIYS VSCSPFHRNL FLSAGTDGHV HLYSMLQAPP LTSLQLSLKY LFAVRWSPVR PLVFAAASGK GDVQLFDLQK SSQKPTVLIK QTQDESPVYC LEFNSQQTQL LAAGDAQGTV KVWQLSTEFT EQGPREAEDL DCLAAEVAA. It is sometimes possible for the material contained within the vial of "WDR34, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.