Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of WBSCR16 expression in transfected 293T cell line by WBSCR16 polyclonal antibody. Lane 1: WBSCR16 transfected lysate (51.04kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human WBSCR16 Polyclonal Antibody | anti-WBSCR16 antibody

WBSCR16 (Williams-Beuren Syndrome Chromosome Region 16, WBS16, RCC1-like G Exchanging Factor-like Protein, DKFZp434D0421, MGC189739, MGC44931)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
WBSCR16; Polyclonal Antibody; WBSCR16 (Williams-Beuren Syndrome Chromosome Region 16; WBS16; RCC1-like G Exchanging Factor-like Protein; DKFZp434D0421; MGC189739; MGC44931); Anti -WBSCR16 (Williams-Beuren Syndrome Chromosome Region 16; anti-WBSCR16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WBSCR16.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFGLTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTLAKSFI
Applicable Applications for anti-WBSCR16 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human WBSCR16, aa1-464 (AAH07823.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WBSCR16 expression in transfected 293T cell line by WBSCR16 polyclonal antibody. Lane 1: WBSCR16 transfected lysate (51.04kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WBSCR16 expression in transfected 293T cell line by WBSCR16 polyclonal antibody. Lane 1: WBSCR16 transfected lysate (51.04kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-WBSCR16 antibody
This gene encodes an RCC1-like G-exchanging factor. It is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq].
Product Categories/Family for anti-WBSCR16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,997 Da
NCBI Official Full Name
Williams-Beuren syndrome chromosomal region 16 protein isoform 1
NCBI Official Synonym Full Names
Williams-Beuren syndrome chromosome region 16
NCBI Official Symbol
WBSCR16
NCBI Protein Information
Williams-Beuren syndrome chromosomal region 16 protein; RCC1-like G exchanging factor-like protein
UniProt Protein Name
Williams-Beuren syndrome chromosomal region 16 protein
UniProt Gene Name
WBSCR16
UniProt Entry Name
WBS16_HUMAN

NCBI Description

This gene encodes a protein containing regulator of chromosome condensation 1-like repeats. The encoded protein may function as a guanine nucleotide exchange factor. This gene is located in a region of chromosome 7 that is deleted in Williams-Beuren syndrome, a multisystem developmental disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

Tissue specificity: Ubiquitous. Ref.1

Involvement in disease: WBSCR16 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of WBSCR16 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.

Sequence similarities: Contains 6 RCC1 repeats.

Similar Products

Product Notes

The WBSCR16 wbscr16 (Catalog #AAA649259) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WBSCR16 (Williams-Beuren Syndrome Chromosome Region 16, WBS16, RCC1-like G Exchanging Factor-like Protein, DKFZp434D0421, MGC189739, MGC44931) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WBSCR16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the WBSCR16 wbscr16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALVALVAGA RLGRRLSGPG LGRGHWTAAG RSRSRREAAE AEAEVPVVQY VGERAARADR VFVWGFSFSG ALGVPSFVVP SSGPGPRAGA RPRRRIQPVP YRLELDQKIS SAACGYGFTL LSSKTADVTK VWGMGLNKDS QLGFHRSRKD KTRGYEYVLE PSPVSLPLDR PQETRVLQVS CGRAHSLVLT DREGVFSMGN NSYGQCGRKV VENEIYSESH RVHRMQDFDG QVVQVACGQD HSLFLTDKGE VYSCGWGADG QTGLGHYNIT SSPTKLGGDL AGVNVIQVAT YGDCCLAVSA DGGLFGWGNS EYLQLASVTD STQVNVPRCL HFSGVGKVRQ AACGGTGCAV LNGEGHVFVW GYGILGKGPN LVESAVPEMI PPTLFGLTEF NPEIQVSRIR CGLSHFAALT NKGELFVWGK NIRGCLGIGR LEDQYFPWRV TMPGEPVDVA CGVDHMVTLA KSFI. It is sometimes possible for the material contained within the vial of "WBSCR16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.