Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human WARS2 Polyclonal Antibody | anti-WARS2 antibody

WARS2 (Tryptophan--tRNA Ligase, Mitochondrial, (Mt)TrpRS, Tryptophanyl-tRNA Synthetase, TrpRS) (AP)

Gene Names
WARS2; TrpRS; NEMMLAS; mtTrpRS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WARS2; Polyclonal Antibody; WARS2 (Tryptophan--tRNA Ligase; Mitochondrial; (Mt)TrpRS; Tryptophanyl-tRNA Synthetase; TrpRS) (AP); EC=6.1.1.2; anti-WARS2 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WARS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2875
Applicable Applications for anti-WARS2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human WARS2, aa1-220 (NP_957715.1).
Immunogen Sequence
MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILSMCVLVFLT
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WARS2 expression in transfected 293T cell line by WARS2 polyclonal antibody. Lane 1: WARS2 transfected lysate (24.8kD). Lane 2: Non-transfected lysate. )

Product Categories/Family for anti-WARS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens tryptophanyl tRNA synthetase 2 (mitochondrial) (WARS2), nuclear gene encoding mitochondrial protein, transcript variant 2, mRNA
NCBI Official Synonym Full Names
tryptophanyl tRNA synthetase 2, mitochondrial
NCBI Official Symbol
WARS2
NCBI Official Synonym Symbols
TrpRS; NEMMLAS; mtTrpRS
NCBI Protein Information
tryptophan--tRNA ligase, mitochondrial

NCBI Description

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Research Articles on WARS2

Similar Products

Product Notes

The WARS2 (Catalog #AAA6398458) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WARS2 (Tryptophan--tRNA Ligase, Mitochondrial, (Mt)TrpRS, Tryptophanyl-tRNA Synthetase, TrpRS) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WARS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WARS2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WARS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual