Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VTCN1Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human, Mouse VTCN1 Polyclonal Antibody | anti-VTCN1 antibody

VTCN1 Antibody - middle region

Gene Names
VTCN1; B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
VTCN1; Polyclonal Antibody; VTCN1 Antibody - middle region; anti-VTCN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQP
Sequence Length
282
Applicable Applications for anti-VTCN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VTCN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VTCN1Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VTCN1Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-VTCN1 antibody
This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-VTCN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
V-set domain-containing T-cell activation inhibitor 1 isoform 2
NCBI Official Synonym Full Names
V-set domain containing T cell activation inhibitor 1
NCBI Official Symbol
VTCN1
NCBI Official Synonym Symbols
B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291
NCBI Protein Information
V-set domain-containing T-cell activation inhibitor 1
UniProt Protein Name
V-set domain-containing T-cell activation inhibitor 1
UniProt Gene Name
VTCN1
UniProt Synonym Gene Names
B7H4
UniProt Entry Name
VTCN1_HUMAN

NCBI Description

This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

VTCN1: Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor- associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13.1

Cellular Component: integral to membrane; external side of plasma membrane

Molecular Function: receptor binding

Biological Process: response to protozoan; immune system process; positive regulation of T cell proliferation; negative regulation of T cell activation

Research Articles on VTCN1

Similar Products

Product Notes

The VTCN1 vtcn1 (Catalog #AAA3221643) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VTCN1 Antibody - middle region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's VTCN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VTCN1 vtcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKCYIITSKG KGNANLEYKT GAFSMPEVNV DYNASSETLR CEAPRWFPQP. It is sometimes possible for the material contained within the vial of "VTCN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.