Rabbit anti-Human VPS35 Polyclonal Antibody | anti-VPS35 antibody

VPS35 Antibody - C-terminal region

Cat. Num. AAA3219634

• Gene Names: VPS35; MEM3; PARK17
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: VPS35; Polyclonal Antibody; VPS35 Antibody - C-terminal region; anti-VPS35 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: YNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIH
• Sequence Length: 796

• Applicable Applications for anti-VPS35 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human VPS35
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VPS35 antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Related Product Information for anti-VPS35 antibody

This is a rabbit polyclonal antibody against VPS35. It was validated on Western Blot

Target Description: This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.

Product Categories/Family for anti-VPS35 antibody

Polyclonal; Cell Biology; Membrane & Traffic

NCBI and Uniprot Product Information

• NCBI GI #: 17999541
• NCBI GeneID: 55737
• NCBI Accession #: NP_060676.2
• NCBI GenBank Nucleotide #: NM_018206.5
• UniProt Accession #: Q96QK1
• Molecular Weight: 87 kDa
• NCBI Official Full Name: vacuolar protein sorting-associated protein 35
• NCBI Official Synonym Full Names: VPS35 retromer complex component
• NCBI Official Symbol: VPS35
• NCBI Official Synonym Symbols: MEM3; PARK17
• NCBI Protein Information: vacuolar protein sorting-associated protein 35
• UniProt Protein Name: Vacuolar protein sorting-associated protein 35
• Protein Family: Vacuolar protein sorting-associated protein
• UniProt Gene Name: VPS35
• UniProt Synonym Gene Names: MEM3; hVPS35
• UniProt Entry Name: VPS35_HUMAN

NCBI Description

This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. [provided by RefSeq, Jul 2008]