Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of VGLL3 transfected lysate using VGLL3 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with VGLL3 mouse polyclonal antibody.)

Rabbit anti-Human VGLL3 Polyclonal Antibody | anti-VGLL3 antibody

VGLL3 (Transcription Cofactor Vestigial-like Protein 3, VGL3, Vgl-3)

Gene Names
VGLL3; VGL3; VGL-3
Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
VGLL3; Polyclonal Antibody; VGLL3 (Transcription Cofactor Vestigial-like Protein 3; VGL3; Vgl-3); Anti -VGLL3 (Transcription Cofactor Vestigial-like Protein 3; anti-VGLL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VGLL3.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Applicable Applications for anti-VGLL3 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human VGLL3, aa1-320 (AAH94780.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of VGLL3 transfected lysate using VGLL3 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with VGLL3 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of VGLL3 transfected lysate using VGLL3 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with VGLL3 mouse polyclonal antibody.)
Product Categories/Family for anti-VGLL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36,009 Da
NCBI Official Full Name
VGLL3 protein
NCBI Official Synonym Full Names
vestigial like 3 (Drosophila)
NCBI Official Symbol
VGLL3
NCBI Official Synonym Symbols
VGL3; VGL-3
NCBI Protein Information
transcription cofactor vestigial-like protein 3; vestigial-like 3; colon carcinoma related protein
UniProt Protein Name
Transcription cofactor vestigial-like protein 3
UniProt Gene Name
VGLL3
UniProt Synonym Gene Names
Vgl-3
UniProt Entry Name
VGLL3_HUMAN

Uniprot Description

VGLL3: May act as a specific coactivator for the mammalian TEFs. Belongs to the vestigial family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 3p12.1

Cellular Component: nucleus

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on VGLL3

Similar Products

Product Notes

The VGLL3 vgll3 (Catalog #AAA6003436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VGLL3 (Transcription Cofactor Vestigial-like Protein 3, VGL3, Vgl-3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VGLL3 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the VGLL3 vgll3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSCAEVMYHP QPYGASQYLP NPMAATTCPT AYYQPAPQPG QQKKLAVFSK MQDSLEVTLP SKQEEEDEEE EEEEKDQPAE MEYLNSRCVL FTYFQGDIGS VVDEHFSRAL GQAITLHPES AISKSKMGLT PLWRDSSALS SQRNSFPTSF WTSSYQPPPA PCLGGVHPDF QVTGPPGTFS AADPSPWPGH NLHQTGPAPP PAVSESWPYP LTSQVSPSYS HMHDVYMRHH HPHAHMHHRH RHHHHHHHPP AGSALDPSYG PLLMPSVHAA RIPAPQCDIT KTEPTTVTSA TSAWAGAFHG TVDIVPSVGF DTGWSAMARS. It is sometimes possible for the material contained within the vial of "VGLL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.