Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-VDAC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit VDAC2 Polyclonal Antibody | anti-VDAC2 antibody

VDAC2 antibody - N-terminal region

Gene Names
VDAC2; POR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
VDAC2; Polyclonal Antibody; VDAC2 antibody - N-terminal region; anti-VDAC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV
Sequence Length
294
Applicable Applications for anti-VDAC2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-VDAC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-VDAC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-VDAC2 AntibodyTitration: 1.6 ug/mlPositive Control: human cell lines)

Western Blot (WB) (WB Suggested Anti-VDAC2 AntibodyTitration: 1.6 ug/mlPositive Control: human cell lines)

Western Blot (WB)

(WB Suggested Anti-VDAC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293TVDAC2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-VDAC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293TVDAC2 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-VDAC2 antibody
This is a rabbit polyclonal antibody against VDAC2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
Product Categories/Family for anti-VDAC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
voltage-dependent anion-selective channel protein 2 isoform 2
NCBI Official Synonym Full Names
voltage dependent anion channel 2
NCBI Official Symbol
VDAC2
NCBI Official Synonym Symbols
POR
NCBI Protein Information
voltage-dependent anion-selective channel protein 2
UniProt Protein Name
Voltage-dependent anion-selective channel protein 2
UniProt Gene Name
VDAC2
UniProt Synonym Gene Names
VDAC-2; hVDAC2
UniProt Entry Name
VDAC2_HUMAN

NCBI Description

This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

VDAC2: Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation- selective. Interacts with hexokinases. Expressed in all tissues examined. Belongs to the eukaryotic mitochondrial porin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Mitochondrial; Channel, misc.

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: pore complex; mitochondrial outer membrane; mitochondrion; mitochondrial inner membrane; nucleus

Molecular Function: protein binding; nucleotide binding; voltage-gated anion channel activity; porin activity

Biological Process: negative regulation of protein polymerization; transmembrane transport; anion transport

Research Articles on VDAC2

Similar Products

Product Notes

The VDAC2 vdac2 (Catalog #AAA3202436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VDAC2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VDAC2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the VDAC2 vdac2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATHGQTCAR PMCIPPSYAD LGKAARDIFN KGFGFGLVKL DVKTKSCSGV. It is sometimes possible for the material contained within the vial of "VDAC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.