Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GM71Sample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse VCPKMT Polyclonal Antibody | anti-VCPKMT antibody

VCPKMT Antibody - middle region

Gene Names
Vcpkmt; Gm71; VCP-KMT; Mettl21d; Mettl221d
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
VCPKMT; Polyclonal Antibody; VCPKMT Antibody - middle region; anti-VCPKMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEQRTMGKNPEIEKKYFELLQLDFDFEEIPLDKHDEEYRSEDIHIVYIRK
Sequence Length
228
Applicable Applications for anti-VCPKMT antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse GM71
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GM71Sample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GM71Sample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-VCPKMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
protein-lysine methyltransferase METTL21D
NCBI Official Synonym Full Names
valosin containing protein lysine (K) methyltransferase
NCBI Official Symbol
Vcpkmt
NCBI Official Synonym Symbols
Gm71; VCP-KMT; Mettl21d; Mettl221d
NCBI Protein Information
protein-lysine methyltransferase METTL21D
UniProt Protein Name
Protein-lysine methyltransferase METTL21D
UniProt Gene Name
Vcpkmt
UniProt Synonym Gene Names
Gm71; Mettl21d; VCP-KMT
UniProt Entry Name
MT21D_MOUSE

Uniprot Description

METTL21D: a methyltransferase of the METTL21 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase, protein lysine; EC 2.1.1.-

Cellular Component: cytoplasm

Molecular Function: methyltransferase activity; monomethylamine methyltransferase activity; trimethylamine methyltransferase activity; tRNA (cytosine)-methyltransferase activity; RNA methyltransferase activity; rRNA (cytosine-C5-967)-methyltransferase activity; rRNA (uridine) methyltransferase activity; N-methyltransferase activity; tRNA (guanine) methyltransferase activity; rRNA (adenine-N6,N6-)-dimethyltransferase activity; arginine N-methyltransferase activity; selenocysteine methyltransferase activity; methanol-specific methylcobalamin:coenzyme M methyltransferase activity; protein-arginine N-methyltransferase activity; tRNA (guanine-N2-)-methyltransferase activity; dimethylamine methyltransferase activity; protein methyltransferase activity; 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity; transferase activity; hydroxyneurosporene-O-methyltransferase activity; rRNA (uridine-2'-O-)-methyltransferase activity; tRNA (uracil) methyltransferase activity; rRNA (adenine) methyltransferase activity; C-methyltransferase activity; cobalt-precorrin-6B C5-methyltransferase activity; cobalt-precorrin-3 C17-methyltransferase activity; 1-phenanthrol methyltransferase activity; S-methyltransferase activity; lysine N-methyltransferase activity; DNA-methyltransferase activity; tRNA (cytosine-5-)-methyltransferase activity; tRNA (adenine)-methyltransferase activity; C-terminal protein carboxyl methyltransferase activity; rRNA (cytosine) methyltransferase activity; cobalt-precorrin-7 C15-methyltransferase activity; protein-arginine N5-methyltransferase activity; rRNA methyltransferase activity; protein-leucine O-methyltransferase activity; demethylmenaquinone methyltransferase activity; rRNA (adenine-N6-)-methyltransferase activity; tRNA methyltransferase activity; rRNA (guanine) methyltransferase activity; methylarsonite methyltransferase activity; mRNA methyltransferase activity; methylamine-specific methylcobalamin:coenzyme M methyltransferase activity; tRNA (guanine-N1-)-methyltransferase activity; cobalt-precorrin-5B C1-methyltransferase activity; protein-lysine N-methyltransferase activity; O-methyltransferase activity; tRNA (adenine-57, 58-N(1)-) methyltransferase activity; tRNA (adenine-N1-)-methyltransferase activity

Biological Process: methylation; peptidyl-lysine tri-methylation

Research Articles on VCPKMT

Similar Products

Product Notes

The VCPKMT vcpkmt (Catalog #AAA3224012) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VCPKMT Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's VCPKMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VCPKMT vcpkmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEQRTMGKNP EIEKKYFELL QLDFDFEEIP LDKHDEEYRS EDIHIVYIRK. It is sometimes possible for the material contained within the vial of "VCPKMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.