Western Blot (WB)
(Western Blot: Sample: Rat Serum.)
Rabbit anti-Rat Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) Polyclonal Antibody | anti-VEGFR2 antibody
Polyclonal Antibody to Vascular Endothelial Growth Factor Receptor 2 (VEGFR2)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-NTTLQ ITCRGQRDLD WLWPNTPRDS EERVLVTECG DSIFCKTLTV PRVVGNDTGA YKCFYRDTDV SSIVYVYVQD HRSPFIASVS DEHGIVYITE NKNKTVVIPC RGSISNLNVS LCARYPEKRF VPDGNRISWD SEKGFTIPSY MISYAGMVFC EAKINDETYQ SIMYIVLVVG YRIYDVVLSP PHEIELSAGE KLVLNCTART ELNVGLDFSW QFPSSKHQHK KIVNRDVKSL PGTVAKMFLS TLTIDSVTKS DQGEYTCTAY SGLMTKKNKT
b. Immunocytochemistry in formalin fixed cells: 5-20ug/m
c. Immunohistochemistry in formalin fixed frozen section: 5-20ug/ml
d. Immunohistochemistry in paraffin section: 5-20ug/ml
e. Optimal working dilutions must be determined by end user.
Western Blot (WB)
(Western Blot: Sample: Rat Serum.)
Western Blot (WB)
(Western Blot: Sample: Rat Serum.)
Western Blot (WB)
(Western Blot: Sample: Recombinant VEGFR2, Rat.)
Western Blot (WB)
(Western Blot: Sample: Recombinant VEGFR2, Rat.)
Immunohistochemistry (IHC)
(DAB staining on IHC-P; Samples: Rat Kidney Tissue.)
Immunohistochemistry (IHC)
(DAB staining on IHC-P; Samples: Rat Kidney Tissue.)
NCBI and Uniprot Product Information
NCBI Description
receptor for vascular endothelial growth factor (VEGF) [RGD, Feb 2006]
Uniprot Description
VEGFR2: a receptor tyrosine kinase of the VEGFR family. High affinity receptor for VEGF and VEGF-C. Ligand binding induces autophosphorylation and activation. Activated receptor recruits proteins including Shc, GRB2, PI3K, Nck, SHP-1 and SHP-2. Plays a key role in vascular development and regulation of vascular permeability.
Protein type: EC 2.7.10.1; Kinase, protein; Membrane protein, integral; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group; VEGFR family
Chromosomal Location of Human Ortholog: 14p11
Cellular Component: cell junction; cell periphery; cell soma; cell surface; cytoplasm; early endosome; endoplasmic reticulum; endosome; external side of plasma membrane; Golgi apparatus; integral component of membrane; integral component of plasma membrane; membrane raft; neuron projection; nucleus; plasma membrane
Molecular Function: ATP binding; growth factor binding; identical protein binding; integrin binding; protein binding; protein tyrosine kinase activity; vascular endothelial growth factor binding; vascular endothelial growth factor-activated receptor activity
Biological Process: aging; alveolus development; angiogenesis; branching morphogenesis of a tube; calcium ion homeostasis; cell fate commitment; cell maturation; cell migration; cell migration during sprouting angiogenesis; elevation of cytosolic calcium ion concentration; embryonic hemopoiesis; endocardium development; endochondral bone growth; endothelial cell differentiation; endothelium development; ERK1 and ERK2 cascade; hemopoiesis; hyaluronan metabolic process; lung development; lymph vessel development; male gonad development; negative regulation of apoptosis; negative regulation of endothelial cell apoptotic process; negative regulation of neuron apoptosis; neuron projection morphogenesis; ovarian follicle development; peptidyl-tyrosine autophosphorylation; peptidyl-tyrosine phosphorylation; positive regulation of angiogenesis; positive regulation of blood vessel diameter; positive regulation of BMP signaling pathway; positive regulation of calcium-mediated signaling; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway; positive regulation of endothelial cell migration; positive regulation of endothelial cell proliferation; positive regulation of epithelial cell proliferation; positive regulation of ERK1 and ERK2 cascade; positive regulation of focal adhesion assembly; positive regulation of long-term neuronal synaptic plasticity; positive regulation of macroautophagy; positive regulation of MAPK cascade; positive regulation of mesenchymal cell proliferation; positive regulation of mitochondrial depolarization; positive regulation of mitochondrial fission; positive regulation of neurogenesis; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of positive chemotaxis; positive regulation of protein phosphorylation; positive regulation of TOR signaling pathway; positive regulation of vasculogenesis; post-embryonic camera-type eye morphogenesis; protein autophosphorylation; protein kinase B signaling; regulation of cell shape; regulation of endothelial cell differentiation; regulation of hematopoietic progenitor cell differentiation; response to drug; response to hypoxia; surfactant homeostasis; vascular endothelial growth factor receptor signaling pathway; vascular endothelial growth factor signaling pathway; vasculogenesis
Research Articles on VEGFR2
Similar Products
Product Notes
The VEGFR2 kdr (Catalog #AAA2002600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). a. Western blotting: 0.5-2ug/ml b. Immunocytochemistry in formalin fixed cells: 5-20ug/m c. Immunohistochemistry in formalin fixed frozen section: 5-20ug/ml d. Immunohistochemistry in paraffin section: 5-20ug/ml e. Optimal working dilutions must be determined by end user. . Researchers should empirically determine the suitability of the VEGFR2 kdr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-NTTLQ ITCRGQRDLD WLWPNTPRDS EERVLVTECG DSIFCKTLTV PRVVGNDTGA YKCFYRDTDV SSIVYVYVQD HRSPFIASVS DEHGIVYITE NKNKTVVIPC RGSISNLNVS LCARYPEKRF VPDGNRISWD SEKGFTIPSY MISYAGMVFC EAKINDETYQ SIMYIVLVVG YRIYDVVLSP PHEIELSAGE KLVLNCTART ELNVGLDFSW QFPSSKHQHK KIVNRDVKSL PGTVAKMFLS TLTIDSVTKS DQGEYTCTAY SGLMTKKNKT. It is sometimes possible for the material contained within the vial of "Vascular Endothelial Growth Factor Receptor 2 (VEGFR2), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
