Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB MaxPab polyclonal antibody.Lane 1: VAPB transfected lysate(26.73 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human VAPB Polyclonal Antibody | anti-VAPB antibody

VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C) (FITC)

Gene Names
VAPB; ALS8; VAP-B; VAMP-B
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
VAPB; Polyclonal Antibody; VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C; ALS8; VAMP-B; VAMP-C; VAP-B; VAP-C) (FITC); VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C; VAP-C; anti-VAPB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VAPB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
243
Applicable Applications for anti-VAPB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
VAPB (AAH01712, 1aa-243aa) full-length human protein.
Immunogen Sequence
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB MaxPab polyclonal antibody.Lane 1: VAPB transfected lysate(26.73 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB MaxPab polyclonal antibody.Lane 1: VAPB transfected lysate(26.73 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(VAPB MaxPab rabbit polyclonal antibody. Western Blot analysis of VAPB expression in mouse kidney.)

Western Blot (WB) (VAPB MaxPab rabbit polyclonal antibody. Western Blot analysis of VAPB expression in mouse kidney.)
Related Product Information for anti-VAPB antibody
The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq]
Product Categories/Family for anti-VAPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
VAPB protein
NCBI Official Synonym Full Names
VAMP associated protein B and C
NCBI Official Symbol
VAPB
NCBI Official Synonym Symbols
ALS8; VAP-B; VAMP-B
NCBI Protein Information
vesicle-associated membrane protein-associated protein B/C

NCBI Description

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq, Jul 2008]

Research Articles on VAPB

Similar Products

Product Notes

The VAPB (Catalog #AAA6451820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VAPB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VAPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.