Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VAMP7 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysateVAMP7 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit VAMP7 Polyclonal Antibody | anti-VAMP7 antibody

VAMP7 antibody - N-terminal region

Gene Names
VAMP7; SYBL1; TIVAMP; VAMP-7; TI-VAMP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VAMP7; Polyclonal Antibody; VAMP7 antibody - N-terminal region; anti-VAMP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK
Sequence Length
220
Applicable Applications for anti-VAMP7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VAMP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VAMP7 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysateVAMP7 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-VAMP7 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysateVAMP7 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-VAMP7 antibody
This is a rabbit polyclonal antibody against VAMP7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transpor
Product Categories/Family for anti-VAMP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
vesicle-associated membrane protein 7 isoform 1
NCBI Official Synonym Full Names
vesicle associated membrane protein 7
NCBI Official Symbol
VAMP7
NCBI Official Synonym Symbols
SYBL1; TIVAMP; VAMP-7; TI-VAMP
NCBI Protein Information
vesicle-associated membrane protein 7
UniProt Protein Name
Vesicle-associated membrane protein 7
UniProt Gene Name
VAMP7
UniProt Synonym Gene Names
SYBL1; VAMP-7; Ti-VAMP
UniProt Entry Name
VAMP7_HUMAN

NCBI Description

This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]

Uniprot Description

VAMP7: Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation. Belongs to the synaptobrevin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq28 and Yq12

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; neuron projection; cell surface; intracellular membrane-bound organelle; late endosome membrane; secretory granule membrane; lysosomal membrane; integral to membrane; trans-Golgi network; phagocytic vesicle; pseudopodium; secretory granule; SNARE complex; phagocytic vesicle membrane; membrane; perinuclear region of cytoplasm; apical part of cell; lamellipodium; cytoplasm; plasma membrane; synapse; cell junction

Molecular Function: SNAP receptor activity; protein binding; SNARE binding; syntaxin binding

Biological Process: ER to Golgi vesicle-mediated transport; exocytosis; autophagic vacuole fusion; natural killer cell degranulation; neutrophil degranulation; vesicle fusion with Golgi apparatus; endocytosis; calcium ion-dependent exocytosis; vesicle-mediated transport; vesicle fusion; Golgi to plasma membrane protein transport; endosome to lysosome transport; eosinophil degranulation; post-Golgi vesicle-mediated transport; triacylglycerol transport; phagocytosis, engulfment

Research Articles on VAMP7

Similar Products

Product Notes

The VAMP7 vamp7 (Catalog #AAA3208653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VAMP7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VAMP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VAMP7 vamp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIPSENNKLT YSHGNYLFHY ICQDRIVYLC ITDDDFERSR AFNFLNEIKK. It is sometimes possible for the material contained within the vial of "VAMP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.