Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UTS2R AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit anti-Human UTS2R Polyclonal Antibody | anti-UTS2R antibody

UTS2R antibody - C-terminal region

Gene Names
UTS2R; UTR; UTR2; GPR14; UR-2-R
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UTS2R; Polyclonal Antibody; UTS2R antibody - C-terminal region; anti-UTS2R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP
Sequence Length
389
Applicable Applications for anti-UTS2R antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UTS2R AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-UTS2R AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-UTS2R antibody
This is a rabbit polyclonal antibody against UTS2R. It was validated on Western Blot

Target Description: UTS2R is a high affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Product Categories/Family for anti-UTS2R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
urotensin-2 receptor
NCBI Official Synonym Full Names
urotensin 2 receptor
NCBI Official Symbol
UTS2R
NCBI Official Synonym Symbols
UTR; UTR2; GPR14; UR-2-R
NCBI Protein Information
urotensin-2 receptor
UniProt Protein Name
Urotensin-2 receptor
Protein Family
UniProt Gene Name
UTS2R
UniProt Synonym Gene Names
GPR14; UR-2-R; UR-II-R
UniProt Entry Name
UR2R_HUMAN

Uniprot Description

UTS2R: High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: recycling endosome; membrane; early endosome; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; urotensin II receptor activity

Biological Process: response to drug; G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; elevation of cytosolic calcium ion concentration; positive regulation of fibroblast proliferation; positive regulation of circadian sleep/wake cycle, REM sleep; negative regulation of glomerular filtration; regulation of vasodilation; blood circulation; positive regulation of vasoconstriction; negative regulation of blood pressure; signal transduction; positive regulation of cell growth; positive regulation of blood pressure

Research Articles on UTS2R

Similar Products

Product Notes

The UTS2R uts2r (Catalog #AAA3216077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UTS2R antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UTS2R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UTS2R uts2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WGPRAHRAYL TLLFATSIAG PGLLIGLLYA RLARAYRRSQ RASFKRARRP. It is sometimes possible for the material contained within the vial of "UTS2R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.