Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: USP7Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human USP7 Polyclonal Antibody | anti-USP7 antibody

USP7 Antibody - middle region

Gene Names
USP7; TEF1; HAUSP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
USP7; Polyclonal Antibody; USP7 Antibody - middle region; anti-USP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITD
Sequence Length
1102
Applicable Applications for anti-USP7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human USP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: USP7Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: USP7Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-USP7 antibody
The protein encoded by this gene belongs to the peptidase C19 family, which includes ubiquitinyl hydrolases. This protein deubiquitinates target proteins such as p53 (a tumor suppressor protein) and WASH (essential for endosomal protein recycling), and regulates their activities by counteracting the opposing ubiquitin ligase activity of proteins such as HDM2 and TRIM27, involved in the respective process. Mutations in this gene have been implicated in a neurodevelopmental disorder.
Product Categories/Family for anti-USP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 7 isoform 4
NCBI Official Synonym Full Names
ubiquitin specific peptidase 7
NCBI Official Symbol
USP7
NCBI Official Synonym Symbols
TEF1; HAUSP
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 7
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 7
UniProt Gene Name
USP7
UniProt Synonym Gene Names
HAUSP
UniProt Entry Name
UBP7_HUMAN

NCBI Description

The protein encoded by this gene belongs to the peptidase C19 family, which includes ubiquitinyl hydrolases. This protein deubiquitinates target proteins such as p53 (a tumor suppressor protein) and WASH (essential for endosomal protein recycling), and regulates their activities by counteracting the opposing ubiquitin ligase activity of proteins such as HDM2 and TRIM27, involved in the respective process. Mutations in this gene have been implicated in a neurodevelopmental disorder. [provided by RefSeq, Mar 2016]

Uniprot Description

USP7: an enzyme that removes ubiquitin from its protein substrates. Binds to the herpes virus protein VMW110 that may therefore modulate its substrate specificity or activity to stabilize viral proteins. Regulates MDM2 and has a dynamic role in the p53-MDM2 pathway. Is reported to deubiquitinate and stabilize p53.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nuclear body; PML body; cytosol; nucleus

Molecular Function: protein C-terminus binding; protein binding; p53 binding; cysteine-type endopeptidase activity; ubiquitin protein ligase binding; ubiquitin-specific protease activity; transcription factor binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; maintenance of DNA methylation; viral reproduction; regulation of transcription factor activity; inhibition of NF-kappaB transcription factor; transcription-coupled nucleotide-excision repair; multicellular organismal development; histone deubiquitination

Research Articles on USP7

Similar Products

Product Notes

The USP7 usp7 (Catalog #AAA3223242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP7 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP7 usp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFFKSQGYRD GPGNPLRHNY EGTLRDLLQF FKPRQPKKLY YQQLKMKITD. It is sometimes possible for the material contained within the vial of "USP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.