<
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using USP33 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)
Rabbit USP33 Polyclonal Antibody | anti-USP33 antibody
USP33 Rabbit pAb
Gene Names
USP33; VDU1; KIAA1097; MGC16868; USP33
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
USP33; Polyclonal Antibody; USP33 Rabbit pAb; VDU1; anti-USP33 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETV
Applicable Applications for anti-USP33 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:100
IHC: 1:50-1:200
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human USP33 (NP_963920.1).
Cellular Location
Cytoplasm, Golgi apparatus, centrosome, cytoskeleton, microtubule organizing center, perinuclear region
Positive Samples
HeLa, HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using USP33 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using USP33 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)
Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using USP33 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Western Blot (WB)
(Western blot analysis of extracts of HepG2 cells, using USP33 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human breast cancer using USP33 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human breast cancer using USP33 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded rat ovary using USP33 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded rat ovary using USP33 antibody at dilution of 1:100 (40x lens).)
Immunofluorescence (IF)
(Immunofluorescence analysis of NIH-3T3 cells using USP33 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of NIH-3T3 cells using USP33 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-USP33 antibody
Background: This gene encodes a deubiquinating enzyme important in a variety of processes, including Slit-dependent cell migration and beta-2 adrenergic receptor signaling. The protein is negatively regulated through ubiquitination by von Hippel-Lindau tumor protein (VHL). Alternative splicing results in multiple transcript variants and protein isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 33 isoform 1 [Homo sapiens]
NCBI Official Synonym Full Names
ubiquitin specific peptidase 33
NCBI Official Symbol
USP33
NCBI Official Synonym Symbols
VDU1; KIAA1097; MGC16868; USP33
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 33
Protein Family
UniProt Gene Name
USP33
UniProt Synonym Gene Names
KIAA1097; VDU1
UniProt Entry Name
UBP33_HUMAN
Similar Products
Product Notes
The USP33 usp33 (Catalog #AAA9142204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP33 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USP33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:100. Researchers should empirically determine the suitability of the USP33 usp33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QVMEVEEDPQ TITTEETMEE DKSQSDVDFQ SCESCSNSDR AENENGSRCF SEDNNETTML IQDDENNSEM SKDWQKEKMC NKINKVNSEG EFDKDRDSIS ETVDLNNQET V. It is sometimes possible for the material contained within the vial of "USP33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
