Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 polyclonal antibody. Lane 1: MAPK13 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MAPK13 Polyclonal Antibody | anti-MAPK13 antibody

MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (AP)

Gene Names
MAPK13; SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPK13; Polyclonal Antibody; MAPK13 (Mitogen-activated Protein Kinase 13; MAPK 13; MAP Kinase 13; PRKM13; Mitogen-activated Protein Kinase p38 delta; MAP Kinase p38 delta; p38delta; Stress-activated Protein Kinase 4; SAPK4; MGC99536) (AP); anti-MAPK13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAPK13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAPK13 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MAPK13, aa1-538 (NP_002745.1).
Immunogen Sequence
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 polyclonal antibody. Lane 1: MAPK13 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 polyclonal antibody. Lane 1: MAPK13 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK13 and MAPKAPK3 HeLa cells were stained with MAPK13 rabbit purified polyclonal 1:1200 and MAPKAPK3 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK13 and MAPKAPK3 HeLa cells were stained with MAPK13 rabbit purified polyclonal 1:1200 and MAPKAPK3 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-MAPK13 antibody
MAP kinase p38 delta, a MAPK type protein kinase, is an environmental stress-and inflammatory cytokine-induced kinase that is associated with the regulation of gene expression and cell proliferation. p38delta is phosphorylated by MEK3/MAP2K3 or MKK6/MAP2K6. Activated p38delta has been shown to phosphorylate ATF2, eEF2K, MBP and PHAS-1.
Product Categories/Family for anti-MAPK13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,779 Da
NCBI Official Full Name
mitogen-activated protein kinase 13
NCBI Official Synonym Full Names
mitogen-activated protein kinase 13
NCBI Official Symbol
MAPK13
NCBI Official Synonym Symbols
SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
NCBI Protein Information
mitogen-activated protein kinase 13; MAP kinase 13; MAP kinase p38 delta; mitogen-activated protein kinase p38 delta; stress-activated protein kinase 4
UniProt Protein Name
Mitogen-activated protein kinase 13
UniProt Gene Name
MAPK13
UniProt Synonym Gene Names
PRKM13; SAPK4; MAP kinase 13; MAPK 13; MAP kinase p38 delta
UniProt Entry Name
MK13_HUMAN

NCBI Description

This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

P38D: a proline-directed ser/thr MAP kinase, and one of four p38 kinases that play important roles in cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have a few hundred substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of tau and STH. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator Myb in response to stress which leads to rapid Myb degradation via a proteasome-dependent pathway. Phosphorylates and down-regulates PKD1 during regulation of insulin secretion in pancreatic beta cells. Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. This description may include information from UniProtKB

Protein type: Protein kinase, CMGC; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.24; CMGC group; MAPK family; p38 subfamily; MAPK/p38 subfamily

Chromosomal Location of Human Ortholog: 6p21.31

Cellular Component: cytosol

Molecular Function: MAP kinase activity; protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: peptidyl-serine phosphorylation; regulation of transcription, DNA-dependent; nerve growth factor receptor signaling pathway; transcription, DNA-dependent; Ras protein signal transduction; MAPKKK cascade; response to stress; positive regulation of interleukin-6 production; vascular endothelial growth factor receptor signaling pathway; cell cycle; response to osmotic stress; positive regulation of inflammatory response

Research Articles on MAPK13

Similar Products

Product Notes

The MAPK13 mapk13 (Catalog #AAA6384884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK13 mapk13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPK13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.