Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UNG rabbit polyclonal antibody. Western Blot analysis of UNG expression in mouse liver.)

Rabbit anti-Human, Mouse Uracil-DNA Glycosylase Polyclonal Antibody | anti-UDG antibody

Uracil-DNA Glycosylase (UDG, UNG, DGU, UNG1, UNG15) (Biotin)

Gene Names
UNG; DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Uracil-DNA Glycosylase; Polyclonal Antibody; Uracil-DNA Glycosylase (UDG; UNG; DGU; UNG1; UNG15) (Biotin); EC=3.2.2.27; UNG2; HIGM4; HIGM5; anti-UDG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UNG. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-UDG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human UNG, aa1-304 (NP_003353.1).
Immunogen Sequence
MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UNG rabbit polyclonal antibody. Western Blot analysis of UNG expression in mouse liver.)

Western Blot (WB) (UNG rabbit polyclonal antibody. Western Blot analysis of UNG expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of UNG expression in transfected 293T cell line by UNG polyclonal antibody. Lane 1: UNG transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UNG expression in transfected 293T cell line by UNG polyclonal antibody. Lane 1: UNG transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-UDG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,645 Da
NCBI Official Full Name
uracil-DNA glycosylase isoform UNG1
NCBI Official Synonym Full Names
uracil-DNA glycosylase
NCBI Official Symbol
UNG
NCBI Official Synonym Symbols
DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15
NCBI Protein Information
uracil-DNA glycosylase; uracil-DNA glycosylase 1, uracil-DNA glycosylase 2
UniProt Protein Name
Uracil-DNA glycosylase
Protein Family
UniProt Gene Name
UNG
UniProt Synonym Gene Names
DGU; UNG1; UNG15; UDG
UniProt Entry Name
UNG_HUMAN

NCBI Description

This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010]

Uniprot Description

UNG: Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine. Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5). A rare immunodeficiency syndrome characterized by normal or elevated serum IgM levels with absence of IgG, IgA, and IgE. It results in a profound susceptibility to bacterial infections. Belongs to the uracil-DNA glycosylase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.2.2.27; Hydrolase

Chromosomal Location of Human Ortholog: 12q23-q24.1

Cellular Component: nucleoplasm; mitochondrion; nucleus

Molecular Function: protein binding; uracil DNA N-glycosylase activity

Biological Process: base-excision repair, AP site formation; viral reproduction; depyrimidination; base-excision repair; somatic hypermutation of immunoglobulin genes; somatic recombination of immunoglobulin gene segments; DNA repair; negative regulation of apoptosis

Disease: Immunodeficiency With Hyper-igm, Type 5

Research Articles on UDG

Similar Products

Product Notes

The UDG ung (Catalog #AAA6398064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Uracil-DNA Glycosylase (UDG, UNG, DGU, UNG1, UNG15) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Uracil-DNA Glycosylase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UDG ung for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Uracil-DNA Glycosylase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.