Western Blot (WB)
(Host: RabbitTarget Name: UNKLSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human UNKL Polyclonal Antibody | anti-UNKL antibody
UNKL Antibody - N-terminal region
Gene Names
UNK; ZC3H5; UNKEMPT; ZC3HDC5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UNKL; Polyclonal Antibody; UNKL Antibody - N-terminal region; anti-UNKL antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKH
Sequence Length
810
Applicable Applications for anti-UNKL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UNKL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: UNKLSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: UNKLSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UNKL antibody
This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants.
Product Categories/Family for anti-UNKL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89 kDa
NCBI Official Full Name
RING finger protein unkempt homolog
NCBI Official Synonym Full Names
unk zinc finger
NCBI Official Symbol
UNK
NCBI Official Synonym Symbols
ZC3H5; UNKEMPT; ZC3HDC5
NCBI Protein Information
RING finger protein unkempt homolog
UniProt Protein Name
RING finger protein unkempt homolog
Protein Family
UniProt Gene Name
UNK
UniProt Synonym Gene Names
KIAA1753; ZC3H5; ZC3HDC5
UniProt Entry Name
UNK_HUMAN
Uniprot Description
UNK: Belongs to the unkempt family.
Protein type: RNA-binding; Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 17q25.1
Molecular Function: zinc ion binding
Similar Products
Product Notes
The UNKL unk (Catalog #AAA3224122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UNKL Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UNKL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UNKL unk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEEPRWQETA YVLGNYKTEP CKKPPRLCRQ GYACPYYHNS KDRRRSPRKH. It is sometimes possible for the material contained within the vial of "UNKL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
