Western Blot (WB)
(WB Suggested Anti-Uhmk1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Uhmk1 Polyclonal Antibody | anti-UHMK1 antibody
Uhmk1 antibody - C-terminal region
Gene Names
Uhmk1; KIS; Kist; P-CIP2; AA673513; AI449218; AU021979; 4732477C12Rik; 4930500M09Rik; C820018A03Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Uhmk1; Polyclonal Antibody; Uhmk1 antibody - C-terminal region; anti-UHMK1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDDYLENEDEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANA
Sequence Length
419
Applicable Applications for anti-UHMK1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Uhmk1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Uhmk1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-UHMK1 antibody
This is a rabbit polyclonal antibody against Uhmk1. It was validated on Western Blot
Target Description: Upon serum stimulation,Uhmk1 phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. It may be involved in trafficking and/or processing of RNA.
Target Description: Upon serum stimulation,Uhmk1 phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. It may be involved in trafficking and/or processing of RNA.
Product Categories/Family for anti-UHMK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
serine/threonine-protein kinase Kist isoform 1
NCBI Official Synonym Full Names
U2AF homology motif (UHM) kinase 1
NCBI Official Symbol
Uhmk1
NCBI Official Synonym Symbols
KIS; Kist; P-CIP2; AA673513; AI449218; AU021979; 4732477C12Rik; 4930500M09Rik; C820018A03Rik
NCBI Protein Information
serine/threonine-protein kinase Kist
UniProt Protein Name
Serine/threonine-protein kinase Kist
Protein Family
UniProt Gene Name
Uhmk1
UniProt Synonym Gene Names
Kis; Kist; P-CIP2
UniProt Entry Name
UHMK1_MOUSE
Research Articles on UHMK1
Similar Products
Product Notes
The UHMK1 uhmk1 (Catalog #AAA3205693) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Uhmk1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Uhmk1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UHMK1 uhmk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDDYLENEDE YEDVVEDVKE ECQKYGPVVS LLVPKENPGR GQVFVEYANA. It is sometimes possible for the material contained within the vial of "Uhmk1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
