Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UGCGL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateUGGT2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit UGCGL2 Polyclonal Antibody | anti-UGGT2 antibody

UGCGL2 antibody - N-terminal region

Gene Names
UGGT2; UGT2; HUGT2; UGCGL2
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UGCGL2; Polyclonal Antibody; UGCGL2 antibody - N-terminal region; anti-UGGT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR
Sequence Length
1516
Applicable Applications for anti-UGGT2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UGCGL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UGCGL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateUGGT2 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-UGCGL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateUGGT2 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-UGGT2 antibody
This is a rabbit polyclonal antibody against UGCGL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UGCGL2 recognizes glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
172kDa
NCBI Official Full Name
UDP-glucose:glycoprotein glucosyltransferase 2
NCBI Official Synonym Full Names
UDP-glucose glycoprotein glucosyltransferase 2
NCBI Official Symbol
UGGT2
NCBI Official Synonym Symbols
UGT2; HUGT2; UGCGL2
NCBI Protein Information
UDP-glucose:glycoprotein glucosyltransferase 2
UniProt Protein Name
UDP-glucose:glycoprotein glucosyltransferase 2
UniProt Gene Name
UGGT2
UniProt Synonym Gene Names
UGCGL2; UGT2; UGT2; hUGT2
UniProt Entry Name
UGGG2_HUMAN

NCBI Description

UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.[supplied by OMIM, Oct 2009]

Research Articles on UGGT2

Similar Products

Product Notes

The UGGT2 uggt2 (Catalog #AAA3209202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UGCGL2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UGCGL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UGGT2 uggt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KHTCKINEIK KLLKKAASRT RPYLFKGDHK FPTNKENLPV VILYAEMGTR. It is sometimes possible for the material contained within the vial of "UGCGL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.