Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UFSP1Sample Tissue: Human Fetal Small IntestineAntibody Dilution: 1ug/ml)

Rabbit UFSP1 Polyclonal Antibody | anti-UFSP1 antibody

UFSP1 Antibody - C-terminal region

Gene Names
UFSP1; UFSP
Reactivity
Cow, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UFSP1; Polyclonal Antibody; UFSP1 Antibody - C-terminal region; anti-UFSP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT
Sequence Length
142
Applicable Applications for anti-UFSP1 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human UFSP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UFSP1Sample Tissue: Human Fetal Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UFSP1Sample Tissue: Human Fetal Small IntestineAntibody Dilution: 1ug/ml)
Related Product Information for anti-UFSP1 antibody
This is a rabbit polyclonal antibody against UFSP1. It was validated on Western Blot

Target Description: This gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human UFSP1 protein is shorter on the N-terminus and lacks a conserved Cys active site, it is predicted to be non-functional.
Product Categories/Family for anti-UFSP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
inactive Ufm1-specific protease 1
NCBI Official Synonym Full Names
UFM1 specific peptidase 1 (inactive)
NCBI Official Symbol
UFSP1
NCBI Official Synonym Symbols
UFSP
NCBI Protein Information
inactive Ufm1-specific protease 1
UniProt Protein Name
Inactive Ufm1-specific protease 1
Protein Family
UniProt Gene Name
UFSP1
UniProt Synonym Gene Names
UfSP1
UniProt Entry Name
UFSP1_HUMAN

NCBI Description

This gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human UFSP1 protein is shorter on the N-terminus and lacks a conserved Cys active site, it is predicted to be non-functional.[provided by RefSeq, Nov 2009]

Uniprot Description

UFSP1: a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human UFSP1 protein is shorter on the N-terminus and lacks a conserved Cys active site, it is predicted to be non-functional.[provided by RefSeq, Nov 2009]

Protein type: EC 3.4.22.-

Chromosomal Location of Human Ortholog: 7q22.1

Molecular Function: thiolester hydrolase activity

Biological Process: proteolysis

Research Articles on UFSP1

Similar Products

Product Notes

The UFSP1 ufsp1 (Catalog #AAA3211672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UFSP1 Antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UFSP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UFSP1 ufsp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPHYWGTPKS PSELQAAGWV GWQEVSAAFD PNSFYNLCLT SLSSQQQQRT. It is sometimes possible for the material contained within the vial of "UFSP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.