Western Blot (WB)
(Western blot-UFM1 Polyclonal Antibody)
Rabbit anti-Mouse UFM1 Polyclonal Antibody | anti-UFM1 antibody
UFM1 Polyclonal Antibody
Gene Names
UFM1; HLD14; BM-002; C13orf20
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
UFM1; Polyclonal Antibody; UFM1 Polyclonal Antibody; BM-002; C13orf20; ubiquitin-fold modifier 1; anti-UFM1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.04 mg/ml (varies by lot)
Sequence Length
83
Applicable Applications for anti-UFM1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human UFM1 (NP_057701.1).
Immunogen Sequence
MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Positive Samples
Mouse Pancreas
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-UFM1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-UFM1 Polyclonal Antibody)
Related Product Information for anti-UFM1 antibody
UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 9kDa; 10kDa
Observed: 11kDa
Observed: 11kDa
NCBI Official Full Name
ubiquitin-fold modifier 1 isoform 2
NCBI Official Synonym Full Names
ubiquitin fold modifier 1
NCBI Official Symbol
UFM1
NCBI Official Synonym Symbols
HLD14; BM-002; C13orf20
NCBI Protein Information
ubiquitin-fold modifier 1
UniProt Protein Name
Ubiquitin-fold modifier 1
Protein Family
UniProt Gene Name
UFM1
UniProt Synonym Gene Names
C13orf20
UniProt Entry Name
UFM1_HUMAN
NCBI Description
UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).[supplied by OMIM, Dec 2008]
Uniprot Description
UFM1: Ubiquitin-like modifier protein which binds to a number of target proteins, such as DDRGK1. Belongs to the UFM1 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Ubiquitin-like modifier
Chromosomal Location of Human Ortholog: 13q13.3
Cellular Component: cytoplasm; nucleus
Biological Process: regulation of estrogen receptor signaling pathway
Research Articles on UFM1
Similar Products
Product Notes
The UFM1 ufm1 (Catalog #AAA9140551) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UFM1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UFM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the UFM1 ufm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UFM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
