Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human UCK2 Polyclonal Antibody | anti-UCK2 antibody

UCK2 (Uridine-cytidine Kinase 2, UCK 2, Cytidine Monophosphokinase 2, Testis-specific Protein TSA903, Uridine Monophosphokinase 2, UMPK) (MaxLight 550)

Gene Names
UCK2; UK; UMPK; TSA903
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UCK2; Polyclonal Antibody; UCK2 (Uridine-cytidine Kinase 2; UCK 2; Cytidine Monophosphokinase 2; Testis-specific Protein TSA903; Uridine Monophosphokinase 2; UMPK) (MaxLight 550); EC=2.7.1.48; anti-UCK2 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UCK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-UCK2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human UCK2, aa1-261 (NP_036606.2).
Immunogen Sequence
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-UCK2 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-UCK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
uridine-cytidine kinase 2
NCBI Official Synonym Full Names
uridine-cytidine kinase 2
NCBI Official Symbol
UCK2
NCBI Official Synonym Symbols
UK; UMPK; TSA903
NCBI Protein Information
uridine-cytidine kinase 2; cytidine monophosphokinase 2; testis-specific protein TSA903; uridine kinase; uridine monophosphate kinase; uridine monophosphokinase 2
UniProt Protein Name
Uridine-cytidine kinase 2
Protein Family
UniProt Gene Name
UCK2
UniProt Synonym Gene Names
UMPK; UCK 2
UniProt Entry Name
UCK2_HUMAN

NCBI Description

This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.[provided by RefSeq, Oct 2010]

Uniprot Description

UCK2: Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4- thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)- benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5- methylcytidine, and N(4)-anisoylcytidine. Belongs to the uridine kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.48; Nucleotide Metabolism - pyrimidine; Kinase, other; Xenobiotic Metabolism - drug metabolism - other enzymes

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: intracellular membrane-bound organelle; cytosol

Molecular Function: nucleoside kinase activity; uridine kinase activity; ATP binding

Biological Process: pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; CMP salvage; pyrimidine nucleoside salvage; feeding behavior; response to axon injury; phosphorylation

Research Articles on UCK2

Similar Products

Product Notes

The UCK2 uck2 (Catalog #AAA6397937) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCK2 (Uridine-cytidine Kinase 2, UCK 2, Cytidine Monophosphokinase 2, Testis-specific Protein TSA903, Uridine Monophosphokinase 2, UMPK) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UCK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UCK2 uck2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UCK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual