Mouse anti-Human UBLCP1 Polyclonal Antibody | anti-UBLCP1 antibody

UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1, CPUB1, Nuclear Proteasome Inhibitor UBLCP1)

Cat. Num. AAA649397

• Gene Names: UBLCP1; CPUB1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: UBLCP1; Polyclonal Antibody; UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1; CPUB1; Nuclear Proteasome Inhibitor UBLCP1); Anti -UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1; anti-UBLCP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human UBLCP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLGDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ

• Applicable Applications for anti-UBLCP1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human UBLCP1, aa1-318 (NP_659486).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBLCP1 polyclonal antibody. Western Blot analysis of UBLCP1 expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of UBLCP1 expression in transfected 293T cell line by UBLCP1 polyclonal antibody. Lane 1: UBLCP1 transfected lysate (34.98kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-UBLCP1 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 193083197
• NCBI GeneID: 134510
• NCBI Accession #: NP_659486.2
• NCBI GenBank Nucleotide #: NM_145049.3
• UniProt Accession #: Q8WVY7; Q96DK5; D3DQJ7
• Molecular Weight: 36,805 Da
• NCBI Official Full Name: ubiquitin-like domain-containing CTD phosphatase 1
• NCBI Official Synonym Full Names: ubiquitin-like domain containing CTD phosphatase 1
• NCBI Official Symbol: UBLCP1
• NCBI Official Synonym Symbols: CPUB1
• NCBI Protein Information: ubiquitin-like domain-containing CTD phosphatase 1; nuclear proteasome inhibitor UBLCP1; CTD phosphatase-like with ubiquitin domain 1; CTD-like phosphatase domain-containing protein
• UniProt Protein Name: Ubiquitin-like domain-containing CTD phosphatase 1
• Protein Family: Ubiquitin-like domain-containing CTD phosphatase
• UniProt Gene Name: UBLCP1
• UniProt Entry Name: UBCP1_HUMAN

Uniprot Description

Function: Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome. Ref.1 Ref.8

Catalytic activity: A phosphoprotein + H2O = a protein + phosphate. Ref.1

Cofactor: Magnesium. Ref.1

Subcellular location: Nucleus. Note: Colocalizes with nuclear proteasomes. Ref.1 Ref.8

Tissue specificity: Broadly expressed, with highest levels in placenta, lung, testis and ovary. Up-regulated in tumor tissues. Ref.1

Domain: The Ubiquitin-like domain mediates interaction with proteasomes.

Sequence similarities: Contains 1 FCP1 homology domain.Contains 1 ubiquitin-like domain.

Biophysicochemical propertiespH dependence:Optimum pH is 5.0. Ref.1