Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human UBLCP1 Polyclonal Antibody | anti-UBLCP1 antibody

UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1, CPUB1, Nuclear Proteasome Inhibitor UBLCP1)

Gene Names
UBLCP1; CPUB1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBLCP1; Polyclonal Antibody; UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1; CPUB1; Nuclear Proteasome Inhibitor UBLCP1); Anti -UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1; anti-UBLCP1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBLCP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLGDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
Applicable Applications for anti-UBLCP1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human UBLCP1, aa1-318 (NP_659486).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBLCP1 polyclonal antibody. Western Blot analysis of UBLCP1 expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of UBLCP1 expression in transfected 293T cell line by UBLCP1 polyclonal antibody. Lane 1: UBLCP1 transfected lysate (34.98kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-UBLCP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,805 Da
NCBI Official Full Name
ubiquitin-like domain-containing CTD phosphatase 1
NCBI Official Synonym Full Names
ubiquitin-like domain containing CTD phosphatase 1
NCBI Official Symbol
UBLCP1
NCBI Official Synonym Symbols
CPUB1
NCBI Protein Information
ubiquitin-like domain-containing CTD phosphatase 1; nuclear proteasome inhibitor UBLCP1; CTD phosphatase-like with ubiquitin domain 1; CTD-like phosphatase domain-containing protein
UniProt Protein Name
Ubiquitin-like domain-containing CTD phosphatase 1
UniProt Gene Name
UBLCP1
UniProt Entry Name
UBCP1_HUMAN

Uniprot Description

Function: Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome. Ref.1 Ref.8

Catalytic activity: A phosphoprotein + H2O = a protein + phosphate. Ref.1

Cofactor: Magnesium. Ref.1

Subcellular location: Nucleus. Note: Colocalizes with nuclear proteasomes. Ref.1 Ref.8

Tissue specificity: Broadly expressed, with highest levels in placenta, lung, testis and ovary. Up-regulated in tumor tissues. Ref.1

Domain: The Ubiquitin-like domain mediates interaction with proteasomes.

Sequence similarities: Contains 1 FCP1 homology domain.Contains 1 ubiquitin-like domain.

Biophysicochemical propertiespH dependence:Optimum pH is 5.0. Ref.1

Research Articles on UBLCP1

Similar Products

Product Notes

The UBLCP1 ublcp1 (Catalog #AAA649397) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBLCP1 (Ubiquitin-like Domain-containing CTD Phosphatase 1, CPUB1, Nuclear Proteasome Inhibitor UBLCP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBLCP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the UBLCP1 ublcp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALPIIVKWG GQEYSVTTLS EDDTVLDLKQ FLKTLTGVLP ERQKLLGLKV KGKPAENDVK LGALKLKPNT KIMMMGTREE SLGDVLGPPP DNDDVVNDFD IEDEVVEVEN REENLLKISR RVKEYKVEIL NPPREGKKLL VLDVDYTLFD HRSCAETGVE LMRPYLHEFL TSAYEDYDIV IWSATNMKWI EAKMKELGVS TNANYKITFM LDSAAMITVH TPRRGLIDVK PLGVIWGKFS EFYSKKNTIM FDDIGRNFLM NPQNGLKIRP FMKAHLNRDK DKELLKLTQY LKEIAKLDDF LDLNHKYWER YLSKKQGQ. It is sometimes possible for the material contained within the vial of "UBLCP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual