Western Blot (WB)
(Host: RabbitTarget Name: Ube2zSample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Ube2z Polyclonal Antibody | anti-UBE2Z antibody
Ube2z Antibody - C-terminal region
Gene Names
Ube2z; RGD1308347
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ube2z; Polyclonal Antibody; Ube2z Antibody - C-terminal region; anti-UBE2Z antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD
Sequence Length
356
Applicable Applications for anti-UBE2Z antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ube2z
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Ube2zSample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Ube2zSample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-UBE2Z antibody
This is a rabbit polyclonal antibody against Ube2z. It was validated on Western Blot
Target Description: Ube2z catalyzes the covalent attachment of ubiquitin to other proteins. It is a specific substrate for UBA6, not charged with ubiquitin by UBE1 and may be involved in apoptosis regulation.
Target Description: Ube2z catalyzes the covalent attachment of ubiquitin to other proteins. It is a specific substrate for UBA6, not charged with ubiquitin by UBE1 and may be involved in apoptosis regulation.
Product Categories/Family for anti-UBE2Z antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 Z
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2Z
NCBI Official Symbol
Ube2z
NCBI Official Synonym Symbols
RGD1308347
NCBI Protein Information
ubiquitin-conjugating enzyme E2 Z
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 Z
Protein Family
UniProt Gene Name
Ube2z
UniProt Synonym Gene Names
Use1
UniProt Entry Name
UBE2Z_RAT
Similar Products
Product Notes
The UBE2Z ube2z (Catalog #AAA3215812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ube2z Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Ube2z can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2Z ube2z for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISSVLISIQS LMTENPYHNE PGFEQERHPG DSKNYNECIR HETIRVAVCD. It is sometimes possible for the material contained within the vial of "Ube2z, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
